KEGG   Fusarium oxysporum: FOXG_09906Help
Entry
FOXG_09906        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
fox  Fusarium oxysporum
Pathway
fox00010  Glycolysis / Gluconeogenesis
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
fox01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FOXG_09906
Enzymes [BR:fox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     FOXG_09906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 28951423
NCBI-ProteinID: XP_018247337
UniProt: A0A0J9WPM5
Position
11
AA seq 331 aa AA seqDB search
MGKGGLDESIPQFAGVHSGAGTLPAVKEALESVDTVIWIGNYPSDFNTGEFTTVVNKDAI
VIDLQRFAVSTGKIQYPVSMKHILQRLVNSLRSNPISMASRHITWNPYPKFNFQASDDLK
QDFLWGKLSSFFRPGDVIIGETGTSAFGLCDTKLPSGVMMFNQTVYGSIGYATGAIVGVG
QAIKESEGKWKRPVLVTGEGSMHLTIRALADMLRWDLKPIIFVLNNGGYTVERLIHGKEA
FYNEVAVLDYSMLGRTFGPAFESKYHGPIKTCGELSSLLRDPNFGNVGCIELVELILPPL
DAPSAVIKTGAAIDAFNKAKAEQGPSGIQGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagggggccttgatgaatccattccccagttcgcaggtgtccactccggggct
ggcactctgcccgccgtgaaagaggcgcttgaatctgttgacacagtcatctggatcggc
aactatccttctgatttcaacacgggcgagtttacgactgttgtaaacaaggatgccatt
gttattgacctccaacgtttcgcggtttcgactggcaagatccagtacccggtctcaatg
aagcatattctgcaacgcctcgtcaattctcttcgttcgaacccgatttccatggcttca
cgacacataacttggaatccatatccaaagttcaactttcaggccagcgacgacctgaag
caagatttcctctggggtaaactcagctcctttttccgccccggtgatgttatcattggt
gagaccggtacctccgctttcggcctgtgcgataccaaactccccagcggagtgatgatg
ttcaaccaaaccgtatatggcagtattgggtatgctactggtgccattgttggagttggt
caggctatcaaggaaagcgaagggaagtggaagaggcctgtcctcgtcactggagaaggc
tctatgcacctcactattcgggcactggcagatatgctgcggtgggacctcaagccaatc
atattcgtgctcaacaatggcggatacacagtcgagcgtctcattcacggcaaggaagcc
ttttataatgaggtcgcagttctggactattccatgctcggcaggactttcggaccagca
ttcgaatccaagtaccacggtcctatcaagacttgcggagagctatcgtcactccttcga
gaccccaactttggcaatgtaggctgcattgagttggtcgaactcatcttacctcctctc
gacgcaccttctgctgtcatcaagactggtgccgcgatcgatgcattcaacaaagccaag
gctgagcaggggcccagcggtatccaaggtgcttga

DBGET integrated database retrieval system