KEGG   Fusarium oxysporum: FOXG_09916Help
Entry
FOXG_09916        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fox  Fusarium oxysporum
Pathway
fox00052  Galactose metabolism
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FOXG_09916
   00500 Starch and sucrose metabolism
    FOXG_09916
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FOXG_09916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 BNR CHB_HEX_C
Motif
Other DBs
NCBI-GeneID: 28951433
NCBI-ProteinID: XP_018247352
UniProt: A0A0J9WPM8
Position
11
AA seq 606 aa AA seqDB search
MTAIEKYKVTTEAKTYLGTPKRTTMTVKNTTPRPRWHPSPTYHLKAPRGWINDPCAPGYD
ASTGTYHLSYQWNPKSCDWGDITWGHYTSRDGLTWKQNTQNPVLEPSEPYDDKGIFTGCL
HPTGLQGEEGQLTVIYSSITNLPIHWTLPYTRNCAGLSVATSTDGGKTWQKSEQNPILEG
EPEDLTVTGFRDPYLAEWPALDEMRGEASLYGFVSGGVVDGGPTVFLYAISPTDLTQWTY
LGPLIDLPTGFSPSGRWGGDFGVNWECVNFMTLHNESEERPFLLMGTEGGVKPGAKEGRD
QWSLWMAGSLEQTEQGPRIKPEYSGILDHGCLYAPNSYEHPITKNRIVWGWLKEDELTLA
RRESKGWTGYFSIPRELFLYTVENVTRTLTSSLAQVGCIKATENGRGSKTVQTLGIRPLP
DLQGLRRDKPGYWKNIDSDASLGKLADTHTGSWELEATIKVSPNDQGLGFWIRHNEDLSQ
GTAIHFSPQSEKITVDRSKSNHEADIEKDAVSGPFTLFYSDRNGSEELEKLHLRIFCDGD
VLEVFANDRFALSTMVYADTGDCTGLSWFVEGPGASETVFESAKLWENMKEVVEVDEPVI
YERSQL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaattgagaagtataaagtgacgacggaggcgaaaacgtacttgggcactccg
aaaagaactacaatgacggtcaagaacactacaccccgccctcgatggcatccttcgccg
acataccacctcaaggcacctcgaggttggatcaatgatccgtgcgcacccggatatgac
gcctcaacaggcacataccacctatcttatcaatggaaccccaaatcctgcgattggggt
gacatcacttggggtcattacacaagcagagacggtcttacttggaagcaaaacacacaa
aatccagtcctagaaccctctgagccttacgatgacaagggcatcttcactggctgtctt
caccctacaggtcttcaaggagaagaaggccaactcacggttatctactcatccatcaca
aatcttcccatccactggactttgccgtacactcgaaattgcgctggactgtcagtagca
acatcgacagacggtggtaagacatggcagaagagtgaacagaacccaatcttggagggt
gaacccgaagatctcaccgtcacagggttcagagacccatatcttgcagaatggcctgct
ttggatgaaatgagaggcgaggcaagcttgtatggctttgtttctggaggtgttgtcgac
ggtggacctacagtgtttctctacgcgatctcaccgaccgatttgacacagtggacatac
ctcggccccttgatcgatttacccacaggattcagcccctccggacgatggggcggcgac
ttcggtgtcaattgggaatgcgtcaacttcatgactcttcacaacgagtccgaggagcgg
cctttcttgcttatgggaactgaaggaggagttaaacctggtgctaaggagggtcgtgat
cagtggtcgctttggatggctgggtctcttgagcagaccgaacaaggacccaggataaag
cccgagtacagcggaatcctcgaccacggatgtttatacgcacctaactcttacgagcat
cctattacgaagaacaggatcgtctggggatggttgaaggaggacgagcttacattggcc
cgacgcgaatccaagggttggaccggatacttctctatccctcgcgagctatttttatac
acggttgaaaacgtaacgaggactcttacttcatcattggcacaggttggttgcatcaag
gctaccgagaatggaagggggtcaaagacggttcaaacactgggaattcggccactgcca
gatctgcaaggacttagacgagacaagcctggttactggaaaaacatcgacagcgacgcc
agtcttggaaagcttgccgacacacataccggaagctgggagctagaagctacaatcaag
gtctcaccaaacgaccaaggccttggattctggattcgacacaacgaagacttgtcccaa
ggaacagccattcacttctctcctcaaagcgagaagatcaccgtcgatcgaagcaaatcc
aaccacgaagccgatatcgaaaaggatgctgtttccggccctttcactctcttctactca
gacaggaacggctcagaggagttggaaaaacttcatttgagaatcttttgcgacggcgac
gttctcgaggtctttgccaatgatcgcttcgcgttgtcgactatggtttatgcggatact
ggagattgcacgggtttgagctggtttgttgaaggaccaggagcaagcgaaactgttttt
gaatctgctaagttatgggagaacatgaaggaggttgttgaggttgatgaacctgttatt
tatgaacgaagtcagttgtga

DBGET integrated database retrieval system