KEGG   Fusarium oxysporum: FOXG_11509Help
Entry
FOXG_11509        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K00877  hydroxymethylpyrimidine/phosphomethylpyrimidine kinase / thiaminase [EC:2.7.1.49 2.7.4.7 3.5.99.2]
Organism
fox  Fusarium oxysporum
Pathway
fox00730  Thiamine metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FOXG_11509
Enzymes [BR:fox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     FOXG_11509
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     FOXG_11509
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     FOXG_11509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phos_pyr_kin TENA_THI-4 PfkB HK
Motif
Other DBs
NCBI-GeneID: 28952907
NCBI-ProteinID: XP_018249751
UniProt: A0A0D2Y5F4
Position
10
AA seq 510 aa AA seqDB search
MVQGRVLVIAGSDSSGGAGLEADQKVIAAHGCYAMTATTALTAQNTQGVKGIHVIPTDFV
SQQIDACVEDVGVDVVKTGMLASTETIEMVAKTMVKHSIPSLVVDPVMVSTSGATLLPNE
AIQHLCKHLLPHTTVLTPNIPEAILILSQNGQEVPEVRSVQDLETVAQRIQALGPKWVLV
KGGHRPMKEDLTVAETEEERSVVIDVLVGGDGEVVRVKSPYQASSSTHGTGCSLASAIAS
NLAKGLDTPTAVRSACRYIEAAIRTAPGLGKGHGPLNHFHSTYSLPFAPGYFIEWLLERP
DVRDVWKEFVYHPFVMAMGDGTLPLESFKGYIIQDYLYLIHFSRANALAAYKAQNIEDIS
RATEIVQHIMHELKLHTSYCESFGVSIEQIRATPEKQACTAYTRYVLDVGQNGDWVGLQM
ALAPCLLGYGAAAKMLHDHEKTVREGNTYWAWIKNYNEEDYTDAVKLGSTLLEKHIQLQS
PSRIEELVQIFIHALKMEIGFWEMFPAKQT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaggacgagtgcttgtcatcgcggggtcggacagttcgggcggagcaggactt
gaagcggatcagaaagtcatcgctgctcatggctgctacgctatgacggccactacggct
ctgactgcgcaaaacactcaaggcgtcaagggcattcatgtcattcccaccgatttcgtc
tctcagcagatcgatgcttgtgttgaagatgtcggtgtcgatgttgtcaagactggcatg
cttgcttctacagagacgatagagatggttgcaaagaccatggttaagcatagcatcccg
tcacttgtcgtagatccagtcatggtttcgacttctggtgcaacactcctccccaatgaa
gccattcaacatctctgcaagcaccttctaccgcacactacagttctcacgccaaacatt
cctgaagctattcttatcctttcccaaaacggtcaagaagtccctgaggttcgcagtgtg
caagaccttgagactgtagcccagcgaatccaggctctaggtcctaagtgggtgctcgtc
aagggcggacaccggcccatgaaggaggacttgactgtggctgagaccgaagaggagagg
agtgttgttatagacgttcttgttggcggtgatggtgaggttgtcagagtcaagagccca
taccaggcgagctcgagtacccatgggacggggtgctctctggcgtcggccatcgcatca
aacttggccaagggacttgatacacctacggctgttcgatcagcctgccgatacattgaa
gctgccattcgaacagcacctggcctaggcaaggggcatggtcctctaaaccacttccac
tcgacctattctctcccatttgctcccggctacttcatcgagtggcttctcgagcgccct
gatgtccgcgacgtctggaaggagtttgtttaccatcccttcgtcatggctatgggtgac
ggaactctgcctctcgaatccttcaagggctatatcatccaagattacctatacttgatt
cacttttcacgtgccaatgccctcgctgcctacaaggcacaaaacattgaggatatttct
cgagcaacagaaatagttcagcatatcatgcatgaactgaagctccatacctcgtactgc
gagagcttcggtgtgtccatcgagcagattcgagccacaccagagaagcaggcctgcacc
gcatacactcgttatgtccttgacgttggtcaaaatggcgattgggttggtcttcaaatg
gctcttgctccatgcctccttggttatggtgccgcagcaaagatgctccacgaccatgag
aagactgtccgcgagggaaacacgtactgggcgtggatcaagaactacaatgaagaggat
tacactgacgctgtcaagttgggatctaccctgctcgaaaagcatattcaactgcagtca
ccttcgcgaattgaagagcttgttcagatcttcatccatgctctcaagatggaaattggc
ttttgggagatgttccctgccaagcagacctaa

DBGET integrated database retrieval system