KEGG   Fusarium oxysporum: FOXG_13257Help
Entry
FOXG_13257        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
fox  Fusarium oxysporum
Pathway
fox00330  Arginine and proline metabolism
fox00360  Phenylalanine metabolism
fox00380  Tryptophan metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FOXG_13257
   00360 Phenylalanine metabolism
    FOXG_13257
   00380 Tryptophan metabolism
    FOXG_13257
Enzymes [BR:fox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FOXG_13257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 28954528
NCBI-ProteinID: XP_018252435
UniProt: A0A0D2YAD2
Position
12
AA seq 541 aa AA seqDB search
MNWQDIAKESQAKVLNSIPNRWRLDVNQYQDLKDITNVPYICGLLTEEQLKITELTATEI
VKKVETRELKAVQLLEAFAGRAAIAHQLVNCLTEWFYEEGLAQARELDEALEKGGHLKGV
LHGVPIALKDIHCVAGHASTMAFVSARNNIVSQDSAVVAALRNEGAIFFCKTTMPQSAMA
IETVSNLWGRTLNPSNRDLNAGGSSGGDAVLVAMKGTPLTPSTDLGGSIRVPAAFNGLYA
LKPTAARIPKGGMPDLGQSLIQVSFGPICHSIEDMGLLTRVINAHPHNRFDVTCAPAPWR
RIDAPEGKLKIGLMKWDGVVKPHPPILRALERTQQLLIAAGHEVVDFKPPFDCWQALRTT
FDIYYQGGADGTIAALEESGESIIPAFADLLKVFNVRKLPASEILQLSGKVRDYKEQFLA
AWDKTANDGRPIDVLICPPAPGVGYPHDFNTYWGYTSLLNLIDYPSAILPIPGLKVSSEQ
DPLDLEYVPLDTNPYDKPNHETYDPSLVENQAISIQVVGRPFEDEELIQISSSLDALFRG
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaattggcaagacattgccaaggaatctcaagctaaagtgcttaattccatccctaac
cgctggcgattagatgtcaatcagtatcaagacctcaaagatatcaccaatgtgccgtac
atctgcggcctgctcactgaagagcagctcaaaatcacggaactcacagcgacagaaata
gtcaagaaagttgagactcgcgagctgaaagcagtgcaactcttggaggcatttgctggg
cgagctgctatcgcgcatcaactggtcaattgcctgaccgaatggttctatgaagaaggc
ctcgcacaagcaagagagcttgatgaagcgctagagaagggtggtcatctgaagggtgta
ctgcatggtgttcctatcgctctcaaggatatccattgcgttgcaggccatgcttcgaca
atggctttcgtctcagccaggaacaatatcgtcagccaggattccgccgtcgttgctgcc
ttgcgaaatgaaggcgccatattcttctgcaagaccaccatgcctcaatcagctatggca
atcgagacggtcagcaacctctggggtcgcacgttgaacccttctaatcgggacctgaac
gccggaggtagttctggaggcgacgctgtcctggtagctatgaaaggtacacctctcacg
ccctcgactgatctcggcggatcgattcgtgtaccagctgctttcaatggactctatgct
ctcaaaccaacagctgcacgaatcccaaaaggtgggatgccggaccttggtcagagtctg
attcaagtgtcctttggacctatttgtcactccattgaggatatggggttactaacccga
gtcatcaatgctcatcctcacaacagattcgatgtgacttgcgcgcctgctccatggagg
aggatcgacgccccagaagggaagctgaagattgggctgatgaaatgggatggtgtggtg
aagcctcatccaccaattcttcgagcattggagcgtacccaacaactcctgatagcagct
ggtcacgaggttgttgacttcaagccgcccttcgactgctggcaggctttgaggaccacc
ttcgacatatactatcaaggtggagctgatgggaccatcgctgcacttgaagagtctggt
gaatccataatcccagcgtttgccgacttactcaaggtcttcaatgttcggaagcttccc
gcttcagagattctacagttgagtggcaaggtacgagactacaaagagcagttcctggca
gcatgggataaaacagccaacgacggccgtcctatcgacgtcttgatatgtcctccggca
cccggcgttggttatcctcatgacttcaatacatactggggatacacatcgctcctcaac
ctaatcgactatccttctgcgatattgccgataccaggactcaaggtcagctctgagcag
gatcctcttgatttggaatacgtaccgttggacaccaatccctacgataaacccaaccac
gagacttatgaccccagccttgtcgagaaccaagcaataagtatacaagtggtcggtcgt
cctttcgaagacgaagaactcattcaaatatcctcgagtcttgatgcattgtttcgcggt
ctctag

DBGET integrated database retrieval system