KEGG   Fusarium oxysporum: FOXG_17483Help
Entry
FOXG_17483        CDS       T04882                                 

Definition
(RefSeq) N1-acetylpolyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
fox  Fusarium oxysporum
Pathway
fox00330  Arginine and proline metabolism
fox00410  beta-Alanine metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FOXG_17483
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FOXG_17483
Enzymes [BR:fox01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     FOXG_17483
    1.5.3.16  spermine oxidase
     FOXG_17483
    1.5.3.-  
     FOXG_17483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO AlaDh_PNT_C FAD_oxidored GIDA HI0933_like FAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 28958238
NCBI-ProteinID: XP_018258457
UniProt: A0A0C4DJ45
Position
Unknown
AA seq 527 aa AA seqDB search
MKQSPAQLLTVLTAFFTAAEAVSLPPRDKGTCRKTKVAILGAGVAGIAAAQNLTQAKITD
FLIVEHNDYIGGRLRSQQFGRNTKTGKPYTIELGANWVEGIGSLETHENPIWKLAQKHGL
KTTYADYDALKTFDHEGAKNWTDKIAELDAAFENASGDSGHILLDNLQDLSARAGLRTGG
WRPDKNDMYAQAADWWGWDFEAAWTPDESGLVFGVAGDNATFGYFSDVSNLVIDQRGYNY
FLKQEAKTFLKENDPRLLLKTTVEGIEYNKKGVKVTTKDGGCIEASYAICTFSLGVLQKD
VVEFKPKLPHWKQSAIDQFAMGTYTKIFMQFNESFWDTDAQYQLYADPIERGRFPLFQPL
NGKGFLEGSNIIFATVTGEQAYQVERQTDEETEAQVVEVLQSMYPDKKVHKPTAFTYPRW
STEPWAYGSYSNWPVGMTLEKHQNIRANLERLWFAGEANSAEFFGFVHGGYTEGREIGHR
IGRIINGEAGDDEFDMERYEVLHGTTHKDEYNDENGWLFPYDVDGDN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatcaccagcacagcttctgactgtccttacagccttctttaccgcagccgag
gcagtcagcctcccacctcgagataaaggaacctgcaggaagaccaaggttgctattctc
ggagctggtgttgctggtattgctgcagcccagaacctgacccaagcgaaaatcaccgac
ttccttatcgttgaacataatgactatattggaggtcgcctgcgaagtcaacaatttggc
cgaaacaccaagaccggcaagccatacactattgagctaggtgccaactgggtggaaggc
atcggatccctcgagacgcacgagaaccccatttggaaattggcgcagaagcacggctta
aagacaacttacgccgattacgatgccctcaagacgtttgaccacgagggcgccaagaac
tggaccgacaaaatcgccgagctagatgccgcttttgagaatgcgtcaggcgactccggt
cacatcttgctggataacctccaggacctatctgctcgcgctggtcttcgtactggaggc
tggagaccagataagaacgatatgtatgcgcaggcagcagattggtggggatgggacttt
gaggctgcttggacgcctgatgagagcggtcttgtttttggcgtcgctggagacaatgct
acctttggttatttcagcgatgtcagcaacctagttatcgaccagcgcggttataactac
tttctcaagcaggaagccaaaactttcctcaaggagaacgatccacgacttctcctcaag
actaccgttgaaggtattgagtataacaagaagggcgtcaaggtcacaaccaaggatggt
ggctgtatagaagctagctatgctatctgtacattttctctcggtgtattgcagaaggac
gtcgttgagttcaaaccgaagctgcctcactggaagcagagcgctatcgaccaatttgcg
atgggtacatacaccaagatttttatgcaattcaacgagtcattctgggatactgatgcc
cagtatcagctctacgccgaccctattgagcgtggacgttttcctctgtttcagccgctc
aatggtaaaggcttccttgagggatccaacatcatctttgcgacagtcactggcgagcag
gcctaccaagtcgagcgacaaacggatgaagagaccgaagcgcaagtcgtggaggtcctg
cagtccatgtaccctgataagaaggtccataagcctacagcattcacttacccacgctgg
agcaccgaaccctgggcgtatggatcctatagcaactggcctgtaggcatgactcttgag
aagcaccaaaatatacgtgccaacctggaacgcctatggtttgccggtgaggctaattca
gctgaattctttggctttgtccatggtggatacactgagggtcgcgaaattggtcataga
attggtaggatcattaatggagaggctggtgatgatgaatttgatatggagaggtatgag
gttctgcatggaaccactcataaggacgagtacaatgatgagaacggatggttgtttcct
tacgatgttgacggtgacaactga

DBGET integrated database retrieval system