KEGG   Fusarium oxysporum: FOXG_17516Help
Entry
FOXG_17516        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fox  Fusarium oxysporum
Pathway
fox00052  Galactose metabolism
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FOXG_17516
   00500 Starch and sucrose metabolism
    FOXG_17516
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FOXG_17516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 28958271
NCBI-ProteinID: XP_018258530
UniProt: A0A0J9WD16
Position
Unknown
AA seq 594 aa AA seqDB search
MAYQLQQTWKSGFERPRIHFTASSWINDPCAPGYDPWTNTYHVFYQCNPSSCEWGNMSWG
HLVSRDLLTWTPAPVSPVLVPDQIYDSEGVFTGCWVPATNANDRTLRVAYSCVKHLPFHW
STPPYPRHAAGLALATSRDGGITWEKSPRNPILPGEPDSLNITGFRDPYVTAPLSIHHSD
PAKLYGLISGGIQDLGPTTFLYEISQENLEHWKYLNPLVDVPLRYQPSDTWSGNYGINWE
CTNLVTLCAGDVSRHFLIIGAEGDVEKEHVKKDNGPSGVPSRTIRTQLWMSGHLTTNDEG
IIKFRYEHGGFLDNGPYYAANSFWDPIGNRRIVHGWIPEEDITADAAKAKGWNGSLAILR
EVFLLRIPNVKGTCRSKLSEIYPFERLAEPDGSTTVLTLGVRPIREMARHRETSARITEL
ESTVMLPGPDTAASRIIARTQSPSWELEAEIAVHPGCQSVGFHLRHSNDLSIRTTLTFCI
AKETILIERKASNDDQTINKCPDAGPFTLLALTRPDAGDEVIWEKLRIRIFSDGDILEIF
ANDRFALATMVYSENYGPDMGGITAFATGEINSASFETVKVWDGLDVKYIVRET
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccagttacaacagacctggaaaagtggcttcgaacggcctagaatccatttt
acggcaagcagctggatcaacgatccttgtgctccgggatacgacccatggaccaatacc
taccatgtattctaccaatgcaacccatcgagctgcgaatggggtaacatgtcctggggc
catctggtgtctagggatttattgacatggacaccagctccggtttcaccagttcttgtc
ccagaccagatctatgactctgaaggcgtcttcactgggtgctgggttcctgccactaac
gccaacgacaggacactgagggttgcttattcctgtgtgaagcatctgccatttcactgg
agcaccccaccatacccacgtcatgcagccggtttagcactggcaacctcccgcgatgga
ggtatcacttgggaaaagtctcctcgcaatccaatattgcctggtgagccagacagcttg
aacatcactggcttccgcgacccttacgtgacggctccgctgtccatccaccacagtgac
ccggcaaagctttacgggctgatcagtggtgggatacaggatctaggtcctacaaccttt
ctctatgagatatcccaagaaaatcttgagcattggaagtatctcaatcctcttgtggat
gttccgctccgataccaaccgtcagatacgtggagtggcaactacggcatcaactgggag
tgcaccaatttggtgacgctttgcgcaggtgatgtttcacgccacttccttatcatcgga
gctgaaggtgatgttgaaaaggagcacgtgaagaaggacaatggaccctcgggagttcct
tcacgtaccataaggacccagctgtggatgtcaggtcatctcaccacgaatgatgagggc
atcattaaatttcgatacgaacacggtggctttctagataatggaccgtattacgccgcg
aactcgttctgggatcccatcggcaaccgccgcattgtgcacggctggatcccagaagaa
gacatcaccgcagacgctgctaaagcaaagggttggaatggctctctcgcaattctacgg
gaggttttcctccttcggattcccaatgtcaaagggacttgccgcagcaaactctccgaa
atatatccctttgagcgcctagcggaaccggacggttctactaccgttttgactctaggt
gtaaggcctatcagagagatggcgaggcacagggagactagtgccaggataacagagctg
gaatctactgtcatgctgcctgggccagatactgcagcttcccgaataattgctcgcaca
cagtcaccaagctgggagctggaggcggaaattgccgtccatcccggatgccaatccgtt
ggtttccatcttcgtcacagtaacgatctttcgattcgtacgactcttacattctgtatt
gctaaagagaccattctcattgaacggaaagcttccaatgacgatcaaacaattaataaa
tgcccagatgccggaccctttacgctactggcgctgacgcggccggatgcgggagatgaa
gtgatatgggagaagcttagaattcgcatcttctcagacggggatattctcgaaatcttc
gccaacgaccgcttcgcgttggccactatggtgtattccgaaaactacggcccagacatg
ggtggaatcactgcgttcgctaccggagagatcaacagtgcttcatttgaaaccgtaaag
gtttgggatggcttagatgtcaaatacattgtgagagaaacctga

DBGET integrated database retrieval system