KEGG   Fusarium oxysporum: FOXG_21997Help
Entry
FOXG_21997        CDS       T04882                                 

Definition
(RefSeq) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
fox  Fusarium oxysporum
Pathway
fox00130  Ubiquinone and other terpenoid-quinone biosynthesis
fox01100  Metabolic pathways
fox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    FOXG_21997
Enzymes [BR:fox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     FOXG_21997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 28962703
NCBI-ProteinID: XP_018255692
UniProt: A0A0J9WTR9
Position
1
AA seq 257 aa AA seqDB search
MKEVSSATRQLLGVSSKRFTFYHPTHFIQRPYVRLFSTSQSYLSWSGAQDQVQENALPSL
ESTRPRRIVVGITGATGAPYAIRILTLLHHLGVETHLIISKWALATLKYETSMSEADIRG
LASRSYTAKDLSAPIASGSFQHDGMMIVPCSMKTLAAVRSGYCDDLISRAADVTLKEDRK
LLLAIRETPLSSIHLENMLALRRANAIIFPPVPAFYTRPGGIDDIVDQSAGRMLDMIGIF
TDGFERWEGFKKAQTEM
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtctcttccgccacacgccaacttcttggagtgtcttcaaaaaggttcacg
ttctaccaccctactcacttcatacaaagaccttatgtcaggttgttctccacaagccaa
tcgtacttgagctggagtggagcacaagaccaggttcaagagaatgccctcccatctttg
gaatcaacaaggccgaggaggatcgttgtcggaattacaggtgcaacaggtgccccgtac
gccatccgcatcttaactcttcttcaccacctaggtgtggagactcatcttatcattagc
aaatgggcattagccacactcaaatacgaaacatccatgagcgaagctgatattcgaggc
cttgcgagtagatcatacacggcaaaagatctctcagcaccaatcgcttcaggatccttt
cagcatgacggaatgatgattgttccctgtagcatgaaaactcttgctgcagtacgatct
ggttactgcgatgacctaatatcaagagccgccgatgtcacactcaaggaagatcgcaaa
ctactcctagctattcgggaaacacctttgagttctattcatcttgagaatatgcttgct
cttcgtcgtgctaacgccatcatcttccctcctgttccggctttctataccaggcctggg
ggtatcgacgatattgtcgatcaaagtgctggaaggatgttggatatgataggaatattc
actgatgggtttgagcgatgggaggggttcaagaaagctcagactgagatgtag

DBGET integrated database retrieval system