KEGG   Fusarium oxysporum: FOXG_22295Help
Entry
FOXG_22295        CDS       T04882                                 

Definition
(RefSeq) insulysin
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
fox  Fusarium oxysporum
Brite
KEGG Orthology (KO) [BR:fox00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fox01002]
    FOXG_22295
Enzymes [BR:fox01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     FOXG_22295
Peptidases and inhibitors [BR:fox01002]
 Metallo peptidases
  Family M16: pitrilysin family
   FOXG_22295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M
Motif
Other DBs
NCBI-GeneID: 28963001
NCBI-ProteinID: XP_018256632
UniProt: A0A0J9WUY4
Position
3
AA seq 459 aa AA seqDB search
MYSRELNLYFPFIDEEFMFATQPSRYISHLIGHEGPGSIMSYIRSKGWANGLNAGAYPMC
PGTPGIFDMQVCLTEDGLKNYPEIIEIFSRTSLSCFKLKTPASRFTSRISSVMQKTLPRK
WLLSGHSRLREFAPDQIEKALATIHPDNSCMWYGTEYRHDKIPNDLMQECKKAFAVSPQD
RLPTLHLPHKNQFIPNEPEVEKQEMDEQALNLGTQWKKDDIFWVSRANLIVSLKTPLFYA
SAENNVKARLFSDLVRDALEMYSYDAELAGLQYKISLDSRGLFLDVSGYDDKLPVLLDQI
VTTMRDLDIKKYRLRLEDRDIRTKTLIRGPAFDQLRTKEPFGYIVFSMPRTFSMTYGFRF
LIQSEMAPKFLDSRSEAFLVRYADTLEKMNDTEFEGPQRTQCDAAQIKLLTKLEVMEFFN
RRLSPVSSRRDRSSIHLQAQGKAEGVDKRQEEAQKNANM
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgagagaacttaacttgtacttcccattcattgatgaggagttcatgtttgcc
actcagcctagccgatacattagtcatcttatcggacatgagggtcctggaagtatcatg
tcgtacatcaggtccaagggttgggcgaacggtcttaacgctggtgcttaccctatgtgc
cctggcactcctggtatcttcgatatgcaagtttgcttgacagaagatggtcttaagaac
taccctgagatcatcgagatcttttcccgtacatcgctctcctgcttcaagctaaagaca
cctgccagtcgatttaccagccgaatcagctcggttatgcagaagactctgcctcggaaa
tggttgctcagtggccatagccgtctccgagaatttgctcctgaccagatcgagaaagct
cttgctacgattcacccagataactcctgcatgtggtacggaacagagtatcgccatgac
aagattcccaatgatctcatgcaggagtgtaagaaagcctttgcagtctctccccaggat
cgcctacctactcttcacctaccccataagaaccagttcattcccaacgagcccgaggtt
gaaaagcaggaaatggatgagcaggcactgaacctcggaacacaatggaagaaggatgat
attttctgggtttctcgcgccaaccttattgtcagcttgaagacacccctcttctatgct
tcggcagaaaacaacgtcaaggctcgactgttctcggatctggtccgtgatgcgctcgag
atgtactcatacgacgcggaactggctggattgcagtacaagatcagtcttgattctcgt
ggtttgttcttggacgttagcggctatgatgataagctccctgtgctcttggatcaaatc
gttacaacaatgcgggacttagatatcaagaaatatcgtttgagactggaggatcgcgat
attcgaaccaagactctgatacgtgggccagcctttgatcagctccgaactaaggagcca
tttggctacattgtcttcagcatgccccggactttctcgatgacgtatggcttccgcttc
ctcatacagagtgagatggcgccaaagtttctcgattctcgtagcgaggccttcctcgtg
agatatgcggacacattggaaaagatgaatgatacagagttcgagggcccccaacggacc
caatgcgacgccgcacaaattaagcttctgaccaagctcgaagttatggaattcttcaac
cggcgtcttagccctgtctctagtcggagagatcgctcatcgattcatctacaggctcaa
ggcaaggccgagggtgtcgataagcgacaggaagaggctcagaagaatgccaatatgtag

DBGET integrated database retrieval system