KEGG   Faecalibacterium prausnitzii SL3/3: FPR_10380Help
Entry
FPR_10380         CDS       T02592                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
fpa00010  Glycolysis / Gluconeogenesis
fpa00020  Citrate cycle (TCA cycle)
fpa00620  Pyruvate metabolism
fpa01100  Metabolic pathways
fpa01110  Biosynthesis of secondary metabolites
fpa01120  Microbial metabolism in diverse environments
fpa01130  Biosynthesis of antibiotics
fpa01200  Carbon metabolism
Module
fpa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FPR_10380
   00020 Citrate cycle (TCA cycle)
    FPR_10380
   00620 Pyruvate metabolism
    FPR_10380
Enzymes [BR:fpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     FPR_10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 FrhB_FdhB_C
Motif
Other DBs
NCBI-ProteinID: CBL01371
UniProt: D4K958
Position
1064878..1066482
Genome map
AA seq 534 aa AA seqDB search
MAKLDLTKYGITGTTEVVHNPSYEQLFAEETKPELEGYEKGHVSELGAVNVMTGIYTGRS
PKDKFIVMDENSKDTVWWTSDEYKNDNHPASQEAWKAVKEIAQKELSNKRLYVVDAFCGA
NKDTRMAVRFIVEVAWQAHFVTNMFIRPTAEELENFEPDFVVYNASKAKVENYKELGLNS
ETAVLFNITSKEQVIVNTWYGGEMKKGMFSMMNYFLPLKGIASMHCSANTDKNGENTAIF
FGLSGTGKTTLSTDPKRLLIGDDEHGWDDNGVFNFEGGCYAKVINLDKESEPDIYNAIKR
NALLENVTLDAEGHIDFADKSVTENTRVSYPINHIQNIVRPVSSAPAAKNVIFLSADAFG
VLPPVSILTPEQTQYYFLSGFTAKLAGTERGITEPTPTFSACFGQAFLELHPTKYAEELV
KKMKASGAKAYLVNTGWNGTGKRISIKDTRGIIDAILSGAINEAPTKKIPYFDFEVPTAL
PGVDPAILDPRDTYADAAQWEEKAKDLAGRFVKNFAKYEGNEHGKALVSAGPQL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttggatcttaccaagtatggcatcaccggcacgactgaagtcgtgcacaac
ccctcctacgagcagctgttcgccgaggagaccaagcccgagctggaaggctacgagaag
ggtcacgtcagcgagctgggtgctgtgaacgtgatgaccggcatctacaccggccgttct
cccaaggacaagttcatcgtgatggacgagaactccaaggacaccgtgtggtggaccagc
gatgagtacaagaacgacaaccaccccgcttctcaggaggcttggaaggctgtcaaggag
atcgctcagaaggagctgtccaacaagcgcctgtacgtcgtggatgctttctgcggcgcc
aacaaggatacccgcatggcagtgcgtttcatcgtggaagtggcctggcaggcacacttc
gttaccaatatgttcatccgtcccaccgctgaggagctggagaacttcgagcctgatttc
gttgtttacaacgcttccaaggctaaggtcgagaactacaaggagctgggcctgaactcc
gagactgctgtgctgttcaacatcaccagcaaggagcaggtcatcgtcaacacctggtac
ggcggcgagatgaagaagggtatgttctccatgatgaactacttcctgccgctgaagggc
attgcttccatgcactgctctgccaacaccgacaagaacggcgagaacaccgccatcttc
ttcggtctgtccggcaccggcaagaccaccctgtccaccgatcccaagcgtctgctgatc
ggcgatgacgagcacggctgggacgacaacggcgtgttcaacttcgagggcggctgctac
gctaaggtcatcaacctggataaggagtccgagcccgatatctacaacgccatcaagcgc
aacgctctgctggagaacgtcactctggatgccgagggccacatcgacttcgctgacaag
tctgtcaccgagaacacccgtgtgtcctaccccatcaaccacatccagaacatcgtgcgt
cccgtttcttctgctcccgcagcaaagaacgtgatcttcctgtctgctgacgccttcggc
gttctgcccccggtctccatcctgaccccggagcagacccagtactacttcctgtccggc
tttaccgcaaagctggcaggcaccgagcgcggcatcaccgagcccacccccaccttctcc
gcttgcttcggtcaggcctttctggagctgcaccccaccaagtacgctgaggagctggtc
aagaagatgaaggccagcggcgcaaaggcttatctggtcaacaccggctggaacggcacc
ggcaagcgcatctccatcaaggatacccgcggcatcatcgatgcaatcctgagcggtgct
atcaacgaggctcccaccaagaagatcccctacttcgactttgaggttcccaccgctctg
cccggtgttgaccccgccatcctcgatccccgcgacacctacgcagatgccgctcagtgg
gaagagaaggcaaaggatctggccggccgcttcgtgaagaacttcgccaagtacgagggc
aacgagcacggcaaggctctggtctccgcaggcccccagctgtaa

DBGET integrated database retrieval system