KEGG   Faecalibacterium prausnitzii SL3/3: FPR_18610Help
Entry
FPR_18610         CDS       T02592                                 

Definition
(GenBank) Fructose-2,6-bisphosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
fpa00860  Porphyrin and chlorophyll metabolism
fpa01100  Metabolic pathways
Module
fpa_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FPR_18610
Enzymes [BR:fpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     FPR_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBL02097
UniProt: D4KB84
Position
complement(1897444..1898118)
Genome map
AA seq 224 aa AA seqDB search
MKTFKLHLIRHGMTAGNLQGLYIGSGTDLPLCDEGRAQLAELKERFVYPQVDTVFSSPLL
RAVETANILFPGAAHQFTVHDLREAGFGKFEGRPVKDLVHDEDFKKWITPGSGYLPEGAE
PTEQFHARCADSLMKLFEYMIRMDVTEAACVTHGGVIMSMLSQRAVPTRRPEQWMADPGC
GYTVQTDVQLWMRDKLVEAIDIVPFGYADTLQGQAEAEENEAYE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttcaagcttcatctcatccgccacggcatgaccgcgggcaacctgcagggc
ctgtacatcggcagcggcactgacctgcccctgtgcgacgagggccgtgcgcagcttgcc
gagctgaaagagcggttcgtctacccgcaggtagatactgtcttctcctcccccctgctg
cgtgcggtggagactgccaacatcctgttccccggagctgcccaccagtttacggtgcac
gatctgcgggaggccggttttggcaagtttgagggacgtccggtgaaggatctcgtccac
gacgaggacttcaaaaagtggatcaccccgggctccggctatctgccggagggcgcagag
cccaccgagcagttccacgcccgctgcgccgacagcctgatgaagctgtttgagtacatg
atccgcatggacgttaccgaggccgcctgcgtgacccacggcggtgtgatcatgagtatg
ctcagccagcgcgccgtacccacccgccgccccgagcagtggatggcagacccgggctgc
ggctacaccgtgcagaccgatgtacagctgtggatgcgggacaagctggtagaggccatc
gacatcgtaccctttggctacgccgacaccctgcaggggcaggccgaggccgaggagaac
gaggcctacgaataa

DBGET integrated database retrieval system