KEGG   Faecalibacterium prausnitzii SL3/3: FPR_29580Help
Entry
FPR_29580         CDS       T02592                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
fpa00071  Fatty acid degradation
fpa00280  Valine, leucine and isoleucine degradation
fpa00310  Lysine degradation
fpa00362  Benzoate degradation
fpa00620  Pyruvate metabolism
fpa00630  Glyoxylate and dicarboxylate metabolism
fpa00640  Propanoate metabolism
fpa00650  Butanoate metabolism
fpa00900  Terpenoid backbone biosynthesis
fpa01100  Metabolic pathways
fpa01110  Biosynthesis of secondary metabolites
fpa01120  Microbial metabolism in diverse environments
fpa01130  Biosynthesis of antibiotics
fpa01200  Carbon metabolism
fpa01212  Fatty acid metabolism
fpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FPR_29580
   00630 Glyoxylate and dicarboxylate metabolism
    FPR_29580
   00640 Propanoate metabolism
    FPR_29580
   00650 Butanoate metabolism
    FPR_29580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FPR_29580
   00072 Synthesis and degradation of ketone bodies
    FPR_29580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FPR_29580
   00310 Lysine degradation
    FPR_29580
   00380 Tryptophan metabolism
    FPR_29580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FPR_29580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FPR_29580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FPR_29580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpa04147]
    FPR_29580
Enzymes [BR:fpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FPR_29580
Exosome [BR:fpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPR_29580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF3147
Motif
Other DBs
NCBI-ProteinID: CBL03044
UniProt: D4K635
Position
2988109..2989326
Genome map
AA seq 405 aa AA seqDB search
MKKIVIASACRTAIGKFGGTLANVPATELGSIVIKEALNRANVKPEQVDHVYMGCVIQAG
LGQNVARQAALKAGLPIETPAVTVNVVCGSGLNCVNMAAQMIEAGDADIVVAGGMENMDM
APFALQKARYGYRMGAPMGKSEIVDTMVNDALWDACGFNKHMGMTAENVCTNETYQKKYG
YSPITREMLDEFSYNSQLKADKAIKDGAFKDEIVPVVIKGKKGDTVFDTDEGPRLSAPEV
LAKLKPAFTKDGIVTAGNSSAINDGAAALVVMSEEKAKELGVKPLATWVAGALAGVEPEV
MGLGPIAATKKVMAKTGMTVADMDLVEANEAFAAQSIAVGEALGFDKDKLNVNGGAIALG
HPVGASGARILVTLLYAMKHRGAHKGLATLCIGGGMGCATIVEMD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgttatcgcatctgcatgccgcaccgctatcggcaagttcggtggcact
ctggccaacgttcccgctactgagctgggctccatcgtcatcaaggaggctctgaaccgt
gcaaacgtcaagcccgagcaggtcgatcatgtttacatgggctgcgtcattcaggctggt
ctgggccagaacgtcgctcgtcaggctgccctgaaggctggcctgcccatcgagaccccc
gctgtcaccgtcaacgtggtctgcggctctggtctgaactgcgtgaacatggctgctcag
atgatcgaggcaggcgatgctgatatcgttgttgcaggcggcatggagaacatggacatg
gctcccttcgcactgcagaaggctcgctacggctaccgcatgggcgctcccatgggcaag
agcgagatcgtggataccatggtcaacgatgcactgtgggatgcctgcggcttcaacaag
cacatgggcatgaccgctgagaacgtctgcaccaacgagacctaccagaagaagtacggc
tacagccccatcacccgcgagatgctggacgagttctcatacaacagccagctgaaggct
gacaaggccatcaaggacggcgccttcaaggacgagatcgttcctgttgtcatcaagggc
aagaagggcgacaccgtgttcgataccgatgagggcccccgtctgagcgctcccgaggtt
ctggcaaagctgaagcccgccttcaccaaagacggcatcgtcaccgctggtaactcttcc
gccatcaacgacggcgctgctgctctggtcgtcatgagcgaggagaaggctaaggagctg
ggcgtgaagcctctggcaacctgggtcgccggtgctctggcaggcgttgagcccgaggtc
atgggtctgggccccatcgctgctaccaagaaggtcatggccaagaccggcatgaccgtt
gctgatatggatctggtcgaggccaacgaggcattcgcagcacagtccatcgctgtcggc
gaggctctgggcttcgataaggacaagctgaacgtcaacggcggcgcaatcgctttgggt
cacccggtcggcgcttccggcgctcgtatcctggtcaccctgctgtacgctatgaagcac
cgtggtgctcataagggtctggctaccctgtgcatcggcggcggcatgggctgcgctacc
atcgttgagatggactaa

DBGET integrated database retrieval system