KEGG   Flavobacterium pallidum: HYN49_01580Help
Entry
HYN49_01580       CDS       T06077                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
fpal  Flavobacterium pallidum
Brite
KEGG Orthology (KO) [BR:fpal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HYN49_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AWI24685
UniProt: A0A2S1SE59
Position
407284..407670
Genome map
AA seq 128 aa AA seqDB search
MVTQITRGIKISVHTSFEGTYFKNYKIHFAFSYEITIENSSKDSVQLVSRHWEIFDSLNE
LEIVDGEGVIGKKPVLKPGEKHTYSSGCLLSSPFGAMKGYFNMVNFTTTRNFRVIVPNFR
LSAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttacacaaataacgagaggcatcaagatttcagtccataccagttttgaaggcact
tacttcaagaactacaagattcattttgccttcagttatgagattacgatagagaattcc
agcaaagattccgtgcagcttgtgtcacgccactgggaaatcttcgactcattaaacgag
ttggaaattgtggatggtgaaggcgtaatcggcaaaaaacccgttttaaaacccggcgaa
aagcacacttacagctccggctgcctgctttcctccccttttggagccatgaaaggctat
ttcaatatggtcaattttacgacgacaagaaactttcgtgtcattgtcccgaatttccgc
ctcagtgcgccatttgccttaaattaa

DBGET integrated database retrieval system