KEGG   Flavobacterium pallidum: HYN49_11660Help
Entry
HYN49_11660       CDS       T06077                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
fpal  Flavobacterium pallidum
Brite
KEGG Orthology (KO) [BR:fpal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HYN49_11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AWI26501
UniProt: A0A2S1SJE2
Position
complement(2813764..2815038)
Genome map
AA seq 424 aa AA seqDB search
MTLLIIIIVLALIFDYINGFHDAANAIATVVATKVLTPFQAVLWAAFFNFLAYWVFGFGV
ADTVAKTANTMEINLTVILAGVIAAIIWNLFTWWQGIPSSSSHTLIGGFAGAAIAHAGIG
VVSWYKEGKDGGLPSGVLIIISFIVLAPLLGALVSYLISLWLLHSYKKKVLPKLFTLGLM
ALTVWFVEGQVKYYDKIEKPRFDSHFWSVALEQHNIKWFLVAFIIFTISIFCLFFSSLNH
TRSEFWLKKMQLLSSAAFSLGHGGNDSQKVMGIIAAAVAVYVHTHTGQTMPDWLNVILPD
EDGNGSNMPQWIPLACYTAIAAGTLSGGWKIVKTMGSKITKVTSFEGVAAETAGALTLYF
TEHLKIPVSTTHTITGSIIGVGLTKRISAVRWGVTVSLVWAWVLTIPISAVLAAIVYYLL
NIFI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacgttattaatcatcattatcgttcttgcgcttatttttgactacatcaatggtttt
catgatgccgcaaatgcgatagctacagtagtcgccacaaaagtactgacacctttccag
gcggtgctttgggcagctttctttaactttttagcctattgggtttttggttttggcgtt
gccgatacggtggctaaaacggcgaacaccatggaaatcaaccttacggtaatccttgcc
ggtgttattgctgcaatcatctggaatttattcacatggtggcagggaatcccttcaagt
tcctcacacacgcttatcggaggttttgccggtgcggcgattgctcatgccggtatcggc
gtagtctcctggtataaggaagggaaagacggagggctgccttcaggggttttaatcatt
atttcttttattgtacttgcgcctttattgggtgctttggtatcatatcttatttcgctt
tggttgctacattcctataagaaaaaggtgttgccaaagttatttacattaggcctgatg
gcacttaccgtttggtttgttgaaggccaggtaaaatattatgacaagattgaaaagcca
agatttgattcccatttttggagtgtcgctttggagcagcacaatatcaaatggttcctt
gtcgcattcattatttttacgatcagtattttctgcttgtttttcagcagtttgaatcat
acacggtcagagttttggctaaagaaaatgcaattgctttcttcagcggcgtttagcctt
ggccatggcggaaatgattcgcagaaagttatggggatcattgctgcagcggtagccgtt
tacgttcatacgcataccggacaaacgatgcccgactggctgaatgtgatcctgcctgac
gaagatggcaatggctccaatatgccccaatggatcccattagcgtgttacacggcgatt
gccgcaggaacgttaagcggggggtggaaaatcgtgaaaaccatgggttctaaaattacc
aaagtaacatcgtttgaaggtgttgccgcagaaaccgccggagcattaaccttatatttc
acggaacaccttaaaattccggtaagcacaacccatacgattacaggctccattataggg
gtaggattgacaaaaaggatttctgccgtaagatggggtgtcaccgtaagcctggtttgg
gcctgggtactcaccattccgatttcagcggtattggcagcaatagtgtattatttgctg
aatatatttatttaa

DBGET integrated database retrieval system