KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_00458Help
Entry
FPSM_00458        CDS       T03254                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FPSM_00458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIJ36953
UniProt: A0A076NTG6
Position
complement(527349..527735)
Genome map
AA seq 128 aa AA seqDB search
MVIQTTRGIKISVLTTFEGTCFKNNKMHFAFSYHITIENHSKDSVQLITRHWEIHDALNY
LETVDGEGVIGKKPVLKPGETHTYSSGCLLCAPFGTMKGHFEMINFTTTKSFKVIVPAFK
LNALFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtaattcaaaccacaagaggcatcaaaatttcggttctaacaacttttgaaggaaca
tgcttcaaaaacaacaaaatgcactttgcattcagttaccacattacaatcgaaaatcac
agcaaagactccgtacaactcataaccagacattgggaaatacacgatgccctaaattat
ctagaaaccgtagatggcgaaggcgtaataggtaaaaaaccagtgctaaaaccaggcgaa
acccatacatacagctcaggctgtttgctttgcgcaccatttggcacaatgaaaggtcat
ttcgaaatgatcaattttaccaccacaaaatcattcaaagtaatcgttccggccttcaaa
ctaaacgcactatttgcattaaattag

DBGET integrated database retrieval system