KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_01755Help
Entry
FPSM_01755        CDS       T03254                                 

Definition
(GenBank) Cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FPSM_01755
Enzymes [BR:fpc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FPSM_01755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DUF1924 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AIJ38250
UniProt: A0A076P3I8
Position
complement(1940461..1941504)
Genome map
AA seq 347 aa AA seqDB search
MKTKYILLLIMPFFWSCSKVDNTDNYVNIPIDYKVPSNFPPLAYDLNNNPLTEKGFELGK
KIFYDGRLSSDGLISCGFCHIQENAFTHHGHSVSHGVNNEVGIRNAPPIQNLAFQTSFMW
DGAASHLDMQSILPFTNPVEMNGNFGNTIAMMKSDAEYQKLFKIAFINREINSENMLKAL
GQFMVMVTSSNSRFDKYRRHETGGTLTQEELGGYTIFNQKCASCHATDLFTDNSFRNNGL
AINPQVNDIGRFRVTELAQDLHKFKVPSLRNIEKTAPYMHDGRFFTLDAVLDHYSNGIVN
SATLDPSLHTNGVLGISLTSLEKTKLIAFLKTLTDNQYLTDKRFSEY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaatatatattgttactcattatgccttttttttggagttgttctaaagtt
gataatacagataattatgttaatattccaatagactataaagtaccttcaaattttccg
ccattagcttatgatttaaataacaatccattaaccgagaaaggtttcgaattaggaaaa
aaaatattttatgacggaagattatcatcagatggattaatttcttgcggattttgtcat
attcaagaaaatgcttttacgcatcacgggcattctgttagccatggtgtaaataatgaa
gttggaataagaaatgcaccacctattcagaatttagcatttcaaactagttttatgtgg
gacggagcagcaagccatttagacatgcagtctattttaccttttacgaatccggtagaa
atgaatggaaattttggcaatacaattgccatgatgaaatctgatgctgaatatcaaaaa
ttattcaaaatcgcatttattaacagagaaataaactccgaaaatatgctaaaagcatta
ggacagtttatggttatggtaacatcaagtaactcccgttttgataaataccgaagacat
gaaacaggcggaacacttacacaagaagagttaggcggttatactatttttaatcaaaaa
tgtgcctcatgtcatgcaacagatttgtttacagacaattcctttagaaataacggtttg
gcgattaacccacaagttaatgatataggcagatttcgtgtcacagaattagcacaagat
ttgcataaatttaaagttccaagtcttagaaatatagagaaaacagcaccatatatgcat
gatggacggttttttacactcgatgctgttctagatcattactctaatgggattgtaaat
tctgcaacattagatccaagtttgcatacaaatggagtcttaggaatttcattaacgagt
ttagaaaaaacaaaattgatagctttcttaaaaaccttaaccgacaatcaatatcttacc
gataaacgattttcagaatattaa

DBGET integrated database retrieval system