KEGG   Fusobacterium pseudoperiodonticum: CTM68_09140
Entry
CTM68_09140       CDS       T05232                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
fpd  Fusobacterium pseudoperiodonticum
Pathway
fpd00472  D-Arginine and D-ornithine metabolism
fpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CTM68_09140
Enzymes [BR:fpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CTM68_09140
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ATV57824
Position
complement(1825424..1827634)
AA seq 736 aa
MKLKPNEKMNVKAILEDLENYHPQRRGWVWREKKDIVIDGYSYKECSDSLKNYVALPAAA
RYFSNLDPQPNNTITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGTP
QGIGGVPITRKQVRAHRKACDMIEEEVGRAINYHSYISGVAGPEVAVMFAEEGVNGAHQD
PQYNVLYRNVNMYRSFVDAGESKKLMAWADMAQIDGAHNANATAKDGWRVMPELIVQHGL
NSIFSYKVGLKKENICLSTVPPSASPTPCLKLDLPYAVALRDFFDEYRMRAQMNTKYITS
SSREATVTHVMNMLISRLTRADIQSTITPDEGRNVPWHMYNIEACDTAKQSLVGMDDLLS
MVELRKDGYLPKQVRELKERAVLFLEEIIEAGGYFEAVEKGFFVDSGYYPQRNGDGIGRK
QDGGVGAGTVFKRDEDYMAPVTAHFGNNNIAQYGLKETDCPSTLIDGCTLEKPEKIVFID
ELDEEDNVNRRMEETDKFRNTNLVKPEVEWLADGVVQVEIFLPLDQRTAEFAAIEFAKKM
NLTDPEVIHSEVMHPSEGTRIQLKGKVDFFINTDDLVIPEKPEVLSDDEIRAFVDEHPFK
IVAATVGEDEHSVGLKEVIDIKHGGIEKFGMEVEYLGTSVPCEKLVDAAIELNADVILAS
TIISHDDIHYKNMKKLHDLAVEKGIREKVIICAGGTQVTPEIAREQGMDEGFGKYDRGVN
VATFFVKRKKEMLGKK
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaaattaaagccaaatgaaaaaatgaatgtaaaggctatattggaagatttagaaaat
tatcatccccaaagaagaggttgggtatggagagaaaagaaagacatagtaatagatgga
tattcatataaagaatgttctgacagtctaaaaaattatgttgctcttcctgcagcagct
agatatttctcaaacttagatcctcaacctaataacactattacaactgaaatagcttca
ggaagatttgaagatgatataagaagaatgagaatggctgcttggcatggagcagatcat
ataatggttataagaactgctgggcagtctcactttgatggacttattgaaggtacacct
caaggaataggtggagttcctattacaagaaaacaagttagagcacatagaaaagcttgt
gacatgatagaagaagaagttggaagagctataaattatcactcatatataagtggagta
gcaggacctgaagttgctgttatgtttgctgaagaaggagttaacggagctcaccaagat
cctcaatacaatgtcctttatagaaatgtaaatatgtatagatcttttgttgatgctggc
gaatctaaaaaacttatggcatgggcagatatggctcaaatagatggagctcacaatgct
aatgctactgcaaaagatggttggagagtaatgcctgagcttatagtacaacatggacta
aattcaattttttcttacaaagtaggacttaaaaaagaaaatatatgtttgtcaacagtt
ccaccttcagcttctccaactccttgcttaaagttggatttaccttatgctgttgcattg
agagatttctttgatgaatacagaatgagagctcaaatgaacactaagtatataacttca
tcatcaagagaagctactgttactcacgttatgaacatgttaatttctagacttactaga
gcagatattcaatctacaataactcctgatgaaggaagaaatgtaccttggcatatgtat
aatatagaagcttgtgatactgctaaacaaagtcttgttggtatggatgacttactttca
atggttgaacttagaaaagatggctatcttcctaaacaagttagagaacttaaagaaaga
gcagttctatttttagaagaaattattgaagctggtggatactttgaagcagttgaaaaa
ggtttcttcgtagattctggttactatcctcaaagaaatggagatggaataggaagaaaa
caagatggtggagtaggagcaggtacagtatttaagagagatgaagactatatggctcca
gttacagctcactttggaaacaataacatagctcaatatggtttaaaagaaactgattgt
ccttctactctaattgatggatgtactcttgaaaaaccagaaaaaatagtttttatagat
gaactagacgaagaagataatgttaatagaagaatggaagaaacagataagtttagaaat
acaaacttagtaaaacctgaagttgaatggttagctgatggtgttgttcaagttgaaata
ttcttacctcttgatcaaagaactgctgaatttgcagcaattgaatttgctaaaaaaatg
aatttaactgatcctgaagtaatacattctgaagtaatgcatccttctgaaggaactaga
attcaactaaaaggtaaagttgatttttttataaatactgatgacttagttattcctgaa
aagcctgaagttttaagtgatgatgaaataagagcttttgttgatgaacatcccttcaaa
atagttgctgctacagttggagaagatgaacactctgtgggattaaaagaagttatagat
ataaaacatggtggaatagaaaaatttggtatggaagttgaataccttggaacatctgtt
ccttgtgaaaaacttgtagacgctgctatagaattaaatgctgatgttatacttgcttct
actataatatctcatgatgacattcactataaaaatatgaaaaaacttcatgatttagca
gttgaaaaaggtataagagaaaaagttataatctgtgctggaggtactcaagtaactcct
gaaatagctagagaacaaggaatggatgaaggattcggaaaatatgacagaggtgtaaac
gtagctactttctttgttaagagaaagaaagaaatgctaggaaagaaataa

DBGET integrated database retrieval system