KEGG   Fusobacterium periodonticum: CTM68_09330Help
Entry
CTM68_09330       CDS       T05232                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
fpd  Fusobacterium periodonticum
Pathway
fpd00770  Pantothenate and CoA biosynthesis
fpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CTM68_09330 (coaBC)
Enzymes [BR:fpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CTM68_09330 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CTM68_09330 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein EutB YqhG
Motif
Other DBs
NCBI-ProteinID: ATV57858
Position
complement(1862662..1863882)
Genome map
AA seq 406 aa AA seqDB search
MKNILVGVTGGIAAFKSASIVSLLKKKGYNVKVVMTENATNIIGPLTLETLSKNRVYVDM
WDKNPHYEVEHISLADWADIVLIAPATYNIIGKVANGIADDMLSTILSAVALRKPVFFAL
AMNVNMYENPILNENIDKLKAYGYRFIDTNEGLLACNYEAKGRMKEPEEIVDIIERYSIA
SKIDNFRDALKGKKLLITSGRTREDIDPIRYLSNKSSGKMGYSLAQAAVDLGAEVTLVSG
PTNLSVPDGLKEFISVDSAIHMYEKVDEKFKDTDIFIACAAVADYRPKEYQDKKIKKSDL
NLTIELVRNPDILFEMGKKKENQLLVGFAAETNNIIENALKKLEKKRLDMIVANNASTMG
TDTNSIEIIRKDRSSTVINQKSKTELAYDILKEVILDLKKAKDEEK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattttagtaggagttacaggaggaattgctgcattcaaatctgcaagtata
gtatctcttctaaagaagaagggatacaatgtaaaagtagtcatgacagaaaatgccaca
aacataataggtcctttaactcttgagactctttcaaaaaacagagtctatgttgatatg
tgggataaaaatcctcactatgaagttgaacacatttctcttgctgattgggcagatata
gttttaattgcacctgcaacatataatataattggtaaagttgctaatggaattgctgat
gatatgctttctactatactatctgctgttgctttaaggaaacctgttttctttgctctt
gcaatgaatgtaaatatgtatgaaaatcctattcttaatgaaaatatagataaattaaaa
gcttatggttatagatttatagatacgaatgaaggcctactagcttgtaactatgaagct
aaaggtagaatgaaagaaccagaagaaattgttgatataattgaaagatatagcatagct
tctaagattgataattttagagatgctctaaaaggtaaaaaacttcttatcacaagtggt
agaacaagagaagatatagatcctataagatatctttcaaataaatcaagtgggaaaatg
gggtattcacttgctcaagctgctgttgatttaggagctgaagtaactttggtaagtgga
cctacaaatcttagtgttcctgatggacttaaagaatttatttctgttgattctgcaatt
catatgtatgaaaaggtagatgaaaagtttaaagatactgatatttttatagcttgtgct
gcagttgcagactacagacctaaagaatatcaagataaaaaaattaaaaaatcagattta
aatttaacaatagaactagttaggaatcctgatatcctatttgaaatgggtaaaaagaaa
gaaaatcaattattggttggttttgcagcagaaactaataatatcattgagaatgctcta
aaaaaattagaaaagaaaagacttgatatgatagttgcaaataatgcctcaactatggga
acagatactaacagtatagaaatcataagaaaagatagaagttctactgttataaatcaa
aaaagtaaaacagaactagcttatgatattttaaaagaagttattttagatttaaagaag
gctaaagatgaagaaaaataa

DBGET integrated database retrieval system