KEGG   Fusobacterium pseudoperiodonticum: CTM68_10365Help
Entry
CTM68_10365       CDS       T05232                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
fpd  Fusobacterium pseudoperiodonticum
Pathway
fpd00860  Porphyrin and chlorophyll metabolism
fpd01100  Metabolic pathways
Module
fpd_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fpd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTM68_10365
Enzymes [BR:fpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CTM68_10365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO Peptidase_S51 PS_pyruv_trans MobB
Motif
Other DBs
NCBI-ProteinID: ATV58048
Position
2090736..2092226
Genome map
AA seq 496 aa AA seqDB search
MKKANLMVVGTSSGAGKSLFVTALCRIFYKDKYKVSPFKSQNMALNSYITKDGKEMGRAQ
VVQAEASGLEPEVEMNPILLKPSSMNKIQIIVCGKSIGNMSGIEYNQYKKNLIPILKETY
SKIEAKNDIVMIEGAGSPAEINIKEEDISNFAMARIADAPVILVADIDRGGVFASIYGTI
MLLKEEDRKRVKGIVINKFRGNKEVLKPGFEIIENLTGVKTLGVIPYADIDIEDEDSLSE
KYKSFKLNKNSNKIKVSVIKLKHISNVTDIDALSIHDDVEIQFVSERSQIGDEDLIIIPG
SKNTIDDLKWLKESGIAEEIIKKARTKTIIFGICGGFQILGNKVKDPYHIEGDIEELNGL
GLLDLETIMENEKTLVQYTGKLIAEEGLLKDLNNSEIKGYEIHQGLTEGNEKNLTSDNRT
ILVNKNNIIATYLHGIFDNKDFTNNLLNEIRRRKGLEEVNSNISYEEYKIQEFDKLEKLV
RENVDIEEIYKIIGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctaatttaatggttgtaggaacatcttcaggagcaggtaagagtttattt
gtaactgcactgtgtagaattttttataaggataaatacaaagtttctccttttaaatca
caaaatatggcattaaattcatatataacaaaagatggtaaggaaatgggaagagcacaa
gttgtacaggctgaggcaagtggattagagcctgaagttgaaatgaacccaatactatta
aaaccttcaagtatgaataaaatacaaataatagtttgtgggaaatctataggtaatatg
tcaggaattgaatacaatcaatataagaagaatttaattcctatattaaaagaaacttat
tcaaagatagaagctaaaaatgatatagttatgattgaaggagcaggaagtccagcagaa
ataaatataaaagaagaggacatttctaattttgctatggctagaatagcagatgctcct
gttattttagttgctgatatagatagaggaggagttttcgcatctatctatggtacaatt
atgcttttaaaggaagaagatagaaaaagagtaaaaggtattgttataaataaatttaga
ggtaataaggaagttttaaaacctggatttgaaataatagagaatctaacaggagttaaa
actctaggtgtaataccttatgcagatatagatattgaagatgaagatagtttaagtgaa
aaatataagagttttaaattaaataaaaattcaaataaaataaaagtttcggtaataaaa
ttaaaacatatctctaatgttacagatatagatgctttatcaattcatgatgatgttgaa
atacaatttgtaagtgagagaagtcaaattggagatgaagatttaataataatcccaggt
tcaaaaaatactatagatgatttaaaatggcttaaagaaagtggaatagctgaagaaata
ataaaaaaagccagaacaaaaactataatttttggtatttgtggaggttttcaaatttta
ggaaataaagttaaggatccatatcatattgaaggtgatattgaagagttaaatggtcta
ggtcttttagacttagagactattatggaaaatgaaaaaactcttgttcaatatactggg
aaattaattgctgaagaaggacttttaaaggatttaaataattctgaaattaagggttat
gaaattcatcaaggacttacagaaggaaatgaaaagaatttaacaagtgataatagaact
attttagtaaataaaaataatattattgcaacttatttacatggaatttttgacaataaa
gatttcactaataatcttttaaatgaaattagaagaagaaaaggtttagaagaagtaaat
agtaatatttcttatgaagaatataaaatacaagagtttgataagttagaaaaattagtc
agagagaatgttgatatagaagaaatatacaaaattataggactaaaataa

DBGET integrated database retrieval system