KEGG   Fervidobacterium pennivorans: Ferpe_0490Help
Entry
Ferpe_0490        CDS       T01808                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00430  Taurine and hypotaurine metabolism
fpe00620  Pyruvate metabolism
fpe00640  Propanoate metabolism
fpe00680  Methane metabolism
fpe01100  Metabolic pathways
fpe01120  Microbial metabolism in diverse environments
fpe01200  Carbon metabolism
Module
fpe_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:fpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ferpe_0490
   00640 Propanoate metabolism
    Ferpe_0490
  09102 Energy metabolism
   00680 Methane metabolism
    Ferpe_0490
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Ferpe_0490
Enzymes [BR:fpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Ferpe_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK DSPc
Motif
Other DBs
NCBI-ProteinID: AFG34628
UniProt: H9UAT5
Position
524776..525996
Genome map
AA seq 406 aa AA seqDB search
MRVLVVNCGSSSIKYQFLDMDTEQVLCKGLAERIGIPGSRIVHKKDEQKVVIEKPMKDHE
DALKYVLELIVDEKVGGVKDLSEIDAVGHRVVHGGEKFSGSVLIDDEVMRALEEYSYLAP
LHNPPNIMGIRAMMKLLPGVPNVAVFDTAFHSKMPAKAYLYAIPYEYYKKYKIRRYGFHG
TSHRYVSKRTAEILGLDYQKSKIITVHLGNGASVAAVMNGHSIDTSMGFTPLEGLVMGTR
SGDIDPSIVTFLMEKEGLTAEEVYTILNKKSGVLGLTDGFSSDMRDIEDKALEGDPVCRL
ALDIYEYRIAKYIGAYVAAMNGVDAIAFTAGVGENSPITRKEVCENYLGYLGIKIDDEKN
NVKGEERIITTPDSKVKVLVVPTNEELMIARDTKEIIEKGLRQLEY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtcttggttgttaactgtgggagctcgtcgataaagtatcagttccttgatatg
gatacagaacaggtactgtgcaagggacttgcggaaagaataggaatcccaggaagcaga
attgttcacaagaaagatgagcaaaaagttgttattgaaaagccaatgaaagaccatgaa
gacgctctcaaatatgtacttgaactgatagttgacgaaaaggtcggaggagtaaaagac
ttgagtgaaattgatgcggttggtcacagagttgtccatggtggagaaaagttctcaggc
tcagttttgattgatgacgaagtgatgagagcactcgaagaatattcgtaccttgctcca
ctccacaacccaccgaacataatgggtataagagctatgatgaaacttttgccaggagtt
ccaaacgttgcagtctttgatacagcattccattcaaagatgccagcaaaagcgtatctt
tacgcaataccctatgaatactacaagaaatacaaaatcagaaggtatggtttccatgga
acaagccataggtatgtatcaaaaagaactgcagaaatcctgggacttgattatcagaaa
tccaaaatcataacagttcatctcggcaacggagcatccgtagcagctgttatgaatggt
cacagtattgacacatcgatggggtttactccacttgaaggattggtaatgggaacgaga
agcggagacattgacccatcaattgtgacattccttatggaaaaagaaggcttgactgcc
gaagaggtttatacaattcttaacaaaaaaagtggagtacttggcttaacagatggtttc
agctcagatatgagagatatagaagacaaagcacttgagggcgacccagtttgcagactt
gccctggacatttacgaatacagaattgcaaagtatatcggcgcttacgtggctgcaatg
aacggtgttgatgcaatagcatttacagcaggtgtcggtgaaaactccccaataacaagg
aaagaagtttgtgaaaactaccttggttacctcggcataaagatagatgatgagaaaaac
aatgtgaagggtgaagaaaggattataacaacaccagattcaaaagtaaaagttctcgta
gttccaacaaacgaagagctcatgatagcaagagatactaaagagattatagaaaaaggt
ttaaggcagttggaatactaa

DBGET integrated database retrieval system