KEGG   Fervidobacterium pennivorans: Ferpe_1993
Entry
Ferpe_1993        CDS       T01808                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase S subunit
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00472  D-Arginine and D-ornithine metabolism
fpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Ferpe_1993
Enzymes [BR:fpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Ferpe_1993
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A Phage_RpbA
Other DBs
NCBI-ProteinID: AFG36041
UniProt: H9UEU8
Position
2088189..2088563
AA seq 124 aa
MKPRPDDFAERSKHLQNMTDEELNAYFWHLVEKVVDPLVELARTHTSPSIERSVLLRMGF
NSLEAKKLVDMIFERGLLGKGAGHIVWRIAKEHNIDYIEAGRRMINGEYWDDVDRIFKGV
KKNG
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaccaagaccggatgatttcgcagaaaggtctaaacatcttcaaaatatgaccgat
gaagaactcaacgcttacttttggcatcttgtcgagaaagttgttgacccgcttgtcgaa
cttgctagaacacacacaagtccgtctattgaaaggtcagttctgttgagaatgggattc
aatagtctggaagctaaaaagcttgtagacatgattttcgaaaggggactccttggaaag
ggtgccggtcacatcgtctggagaatagcgaaagaacacaacatcgactacattgaagcg
ggaagaagaatgataaatggagaatattgggacgatgttgacaggatattcaaaggggtg
aagaagaatggataa

DBGET integrated database retrieval system