KEGG   Fervidobacterium pennivorans: Ferpe_1994
Entry
Ferpe_1994        CDS       T01808                                 

Definition
(GenBank) putative cobalamin binding protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00472  D-Arginine and D-ornithine metabolism
fpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Ferpe_1994
Enzymes [BR:fpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Ferpe_1994
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AFG36042
UniProt: H9UEU9
Position
2088556..2090754
AA seq 732 aa
MDKLDPKVPIDVEEILKDLDKYRPRRRGWTWRKKLPEGTKVDRYEYYQISEPLKNSIPLP
AAHYFNNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEG
TPEGVGGIPITRKQVRATRKALDLIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAH
QDPQYNILYRGVNPVRSFVDAAVAKKIMAWANMLQIDGAHNANASAKLAWTVMPELLVQH
GINCMFSVKVGMPKENIALSTVPPVIAPLPEMRIDLPYAVALRELFKGFKFRAQMNTRYI
ESDLFDATRVHVLNVVLSRLTSADLQSTITPDEGRNVPWHINSIRGIETAKHTLLAMDGI
KKYVKIDQEAIREKVRELKMRAILMLEEILEMGGYFEALEAGMFVDNGYYPERLGDGIAR
KKDGEIAAGTVVPRDPDYMAPVCEHFGYNNLPEGIEKPCDLIGGCTFHKPEKIQFIDELD
ETDNVNLRLQRIKDMKARNVIKPEVEWYSDGWIQLDMTFALPEEYAEAAALAVCEKLGLE
DPTIIAKTVLHPAEGTYVEVKAKVPFEIKIDELKLPKKPETLPEEEIFEYVAKRPIKVVA
ATVGEDEHSVGLREILDIKHGGIEKYGIKYVYLGTSVPPEKLIDAAIETGADAILASMII
THNDVHIKNMRRLNELAIEKGIRDKVLIIVGGTQINNDMAVENGVDAGFGRGTKGIHVAS
FIVKKLKEREGN
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggataaactcgacccaaaagttccaatcgatgttgaagaaatattaaaagacctcgat
aaataccgcccaagaagaagaggctggacttggagaaagaaacttcctgaaggaacaaag
gttgatagatacgaatattaccaaataagtgaacctttgaaaaacagcattccgttgcca
gctgcgcactatttcaacaacattgacccacaaccggacgttgtcatcacaagtgaaatc
gcttctggaaggttcgaagatgacatcagaagaatgcgcatggcagcctggcatggtgcg
gaccatataatggttattagaactcttggccaatcacactttgacggtcttatcgaagga
acaccggaaggtgttggtggaatacccatcacaagaaagcaggtcagagcgacaagaaaa
gcgttagatttgatagaggatgaagtaggaagacctataaacttccatagctatgtctct
ggtgttgcaggtcccgagattgcagtattgtttgctgaagaaggagtcaacggtgcacac
caagacccacagtacaatattctttatagaggtgttaaccctgttaggtcttttgttgac
gcagcggttgctaagaagataatggcatgggcaaacatgctacaaatcgatggtgcgcac
aacgcaaatgcatcagcaaaattggcatggaccgttatgcctgaacttcttgtccaacat
ggtatcaactgtatgttctcggtaaaggttggcatgccaaaagaaaacatcgcgctatca
actgttcctccagtgattgcaccactaccggagatgagaatagatttaccatacgctgta
gcgcttagagaactctttaaaggtttcaaattcagagctcagatgaacacaagatacatc
gaatcagacttgtttgatgcaacgagggtgcacgttctgaatgtcgtactttcaaggttg
acaagtgcagacttacaatcaacaattaccccggacgaaggaagaaatgtgccatggcat
ataaactccatcagaggaatcgaaacagcaaagcatactctccttgcaatggatggtata
aagaaatacgtaaagattgaccaagaagcaatcagagaaaaagtcagagagctgaaaatg
agagctattctcatgcttgaagagattcttgagatgggcggttatttcgaagcactcgaa
gctggtatgtttgttgacaacggatactatccggaaaggcttggtgatggaattgcacga
aagaaagacggggaaattgcagctggaaccgttgttccaagagacccagattacatggct
ccagtttgtgaacactttggatacaacaacctgcctgaaggcatagaaaaaccgtgtgac
ctcattggtggttgcacattccacaagccagaaaagatacagtttattgatgaactcgac
gagacagataacgtgaacctcagattacagcgtataaaagacatgaaagcaaggaacgtt
atcaaaccggaagtcgaatggtattcagatggctggattcagcttgacatgacattcgca
ttgccagaagaatatgcagaggcagcagcgcttgcggtttgtgagaagctcggacttgag
gacccaacgattattgcaaaaaccgtgctacatcctgctgaaggcacgtatgtcgaagtt
aaagcaaaagttccttttgaaataaaaatagacgaactcaaactgccgaaaaaaccagaa
accctgccagaagaagagatattcgaatatgttgccaaacgtccaattaaagtggtcgct
gcaacggttggggaagacgaacattcagttggattgagagaaatccttgatattaagcat
ggcggtattgaaaaatacggaatcaaatacgtataccttggcacgagtgttccacctgaa
aaacttatcgatgctgcaatcgaaaccggcgctgatgcaatccttgcatccatgataatc
acgcataacgatgttcacatcaagaacatgcgaaggctcaacgaacttgcgatagaaaaa
ggaatcagggataaagtgctaatcattgttggtggaacgcagataaacaacgatatggct
gtagaaaacggtgttgatgctggattcggaagaggcacaaaaggtatccatgtcgcttcg
tttattgtgaagaagctcaaagaaagggaaggaaattaa

DBGET integrated database retrieval system