KEGG   Fervidobacterium pennivorans: Ferpe_2028Help
Entry
Ferpe_2028        CDS       T01808                                 

Definition
(GenBank) pyruvate/oxaloacetate carboxyltransferase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00620  Pyruvate metabolism
fpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ferpe_2028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpe02000]
    Ferpe_2028
Enzymes [BR:fpe01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Ferpe_2028
Transporters [BR:fpe02000]
 Other transporters
  Primary active transporters [TC:3]
   Ferpe_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AFG36075
UniProt: H9UEY2
Position
complement(2126698..2128089)
Genome map
AA seq 463 aa AA seqDB search
MAILNMFTDTTFRDGHQSLIATRMRTKDILGIIDEVDSLGFQALEVWGGATFDVCVRYLN
EDPWERLRLIKSKLRNAKAQMLLRGQNLVGYRHYADDVVELFVKKAIENGVQIIRIFDAL
NDIRNLEKSIEVALKCGAHVQGAISYTVSPVHTIEYYMDYAQQLVERGVHSICIKDMAGL
LTPKVAGELVRNLKQRFGLPIEIHSHATAGLGELAYLAAIEAGADILDTAFSPFGMTTSQ
PAFEPIYYAWSEYKPLPEIDWKKVDRIVKYLTEVRKKYEEYDVKMYSIDHRIITSQVPGG
MYSNLVKQLAEQKMLNKLDAVLEEIPRVRKDLGYPPLVTPTSQIVGVQAVLNVLTGERYS
KVTREVKDYVRGLYGRPPAPIDPELVKKILGDEKPIEGRPADYIEPELEKRKREIGLLAE
TDEDLLIYAILGEVGRQYLKKRYDEKIYVDWSLVNEYEGGYPV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggctatcttgaacatgtttacggatacgacttttcgcgatggtcatcaatctttgata
gccactcgaatgcgaacaaaagatatattaggaataatagacgaagtggacagtctgggc
tttcaagcactagaagtatggggcggtgccacgtttgacgtttgtgtcaggtatctaaat
gaagacccctgggaacgtttaagactcataaagtcaaaactgagaaacgcaaaagcacag
atgctcctgcgtggtcaaaatcttgtcgggtacaggcactacgccgatgatgttgtagaa
ctctttgtcaaaaaagcaatcgaaaatggtgtccaaataattaggatattcgatgcactt
aacgatatcaggaacttggaaaaaagtatagaagttgcgctaaaatgtggcgcacatgtt
caaggagccatatcttacactgttagccccgtccataccattgaatactacatggactac
gctcaacagcttgtcgaacgtggagttcattctatatgcatcaaagacatggcaggatta
ctaacaccaaaagttgctggcgaactggttagaaacctaaaacaaaggtttggtttgcca
atcgagatccattcacatgcaacagcaggactcggagaacttgcttatcttgcagcaatt
gaagcaggcgcagacatccttgacacagccttttcaccattcggaatgacgacaagccag
cccgcttttgaacctatctactacgcttggtcagaatacaaaccacttcctgaaatagat
tggaaaaaagttgataggattgtaaaatatctaacggaagtaagaaagaaatacgaagaa
tacgacgtaaagatgtatagcatagaccacaggataataacttcacaagtgccaggtggg
atgtattcaaaccttgtcaaacaactcgctgaacaaaagatgctcaataaacttgacgct
gtgcttgaagaaatcccacgtgtaagaaaggacctaggctatccccctctggtcactcca
actagtcaaatagttggcgttcaagctgtcctaaacgttttaacaggcgaacgttactcg
aaagtaacaagagaggtcaaggactacgtgcgtggtttgtacggaaggccacctgcaccc
attgaccccgaacttgtaaagaaaatattgggagatgaaaaacctatagaaggaagacct
gctgattacattgaaccagagttagaaaagagaaaaagagaaataggtcttttagctgaa
actgacgaggatttacttatctatgcgattctgggagaagttggtaggcagtatctaaaa
aaacgatacgatgaaaaaatatacgtcgattggtcgcttgtaaatgaatacgaaggaggc
tatccagtttga

DBGET integrated database retrieval system