KEGG   Francisella persica: ACH24_02680Help
Entry
ACH24_02680       CDS       T04357                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
fper  Francisella persica
Pathway
fper00770  Pantothenate and CoA biosynthesis
fper01100  Metabolic pathways
Module
fper_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:fper00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ACH24_02680
Enzymes [BR:fper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ACH24_02680
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ACH24_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_10 KHA
Motif
Other DBs
NCBI-ProteinID: ALB01636
UniProt: A0A0K2JRY0
Position
complement(636219..637394)
Genome map
AA seq 391 aa AA seqDB search
MANRILFGITGSVSAFKTVNLIRLFIKSGTQCKAIVTKGAQQFIKPELLVALGCDVYIDK
KLDMFCYQQSMAHINLPRWADKIFIIPASANTLSKLAYGLANDLLSQVILANKDNSKVYL
APAMNVNMWQNKLTQDNVKKLQALGFNLILPDEGLQACGDSGGGRLHEPEELFKLLDTSQ
DFKDKKVLITVGATVEDIDGVRYLSNYSSGKMGFALVKQLLARGANVTMLKAKTTINFDI
NHSQLKIVKTLSADEMNQAMLELAKDSDIFIGCAAVVDYKIKNKFTNKIKKTDDSLTLEF
IKNPDILINCKQHYPQIFAIGFAAESENIIEYAQAKLIKKNLNMIVANETNVFGKDDSSV
TILSKHQNKQYKTKSKSEIAKIILDFAKEII
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatagaattttgtttggaattactggaagtgtatcagcttttaaaacagtaaat
ctaatccgtctttttataaaaagcggtactcaatgtaaggctattgttactaagggagct
caacaatttattaaacctgagcttttagtagctttaggttgtgatgtttatatagataaa
aaactagatatgttttgttatcagcaaagtatggcacatataaatttaccacgctgggca
gacaagatatttataattcccgcatcagcaaacactctatctaaattagcttatggctta
gctaatgatttacttagtcaagttatccttgctaataaggataattctaaggtgtatctt
gctccagctatgaatgtaaatatgtggcaaaataaactaactcaagataatgtcaaaaaa
cttcaagctttagggtttaatttgatattaccagatgaaggtcttcaagcttgtggcgat
agtggtggtggtagactgcatgagcctgaagagttatttaagttattagatacttctcaa
gattttaaagataaaaaagttctcataacagtaggagcaactgttgaagatattgatggt
gttagatatttatcaaactatagctcgggtaagatgggatttgctttagtaaaacaactg
cttgctagaggtgcaaatgtgactatgcttaaggccaaaaccacaattaattttgatata
aatcatagtcagctaaaaatagttaaaactctaagtgctgatgagatgaatcaagcaatg
ctagagctagcaaaagatagtgatatcttcattggttgtgctgcagttgttgattataaa
atcaaaaataaatttactaataaaattaaaaaaacagatgatagtttaactttagagttt
ataaaaaaccctgatattttgattaattgtaagcagcattatccacaaatttttgcgata
ggttttgctgctgaatcagaaaatataatcgaatatgcccaagctaagcttatcaagaag
aatctaaacatgattgtggcaaatgaaacgaatgtttttggtaaagatgactcttctgtg
acaatattatctaaacaccaaaataaacaatataaaactaaatcaaagtcagaaatagct
aaaataatattagatttcgctaaggagataatatga

DBGET integrated database retrieval system