KEGG   Francisella persica: ACH24_05625Help
Entry
ACH24_05625       CDS       T04357                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
fper  Francisella persica
Pathway
fper00230  Purine metabolism
fper00250  Alanine, aspartate and glutamate metabolism
fper01100  Metabolic pathways
Module
fper_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:fper00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACH24_05625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACH24_05625
Enzymes [BR:fper01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ACH24_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ALB02085
UniProt: A0A0K2JS98
Position
complement(1251383..1252669)
Genome map
AA seq 428 aa AA seqDB search
MSNIVIVGAQWGDEGKGKIVDTLAEKADFVVRYQGGNNAGHTLVVNGKKTFLHLIPSGIL
HQHTKCVIGHGVVLDPVALDEEITRLQATGIAISAENLFVSESCTIITSYHKLLDAVRES
STSEKIGTTGKGIGPAYEDKVSRKGTKFKHLFDKDILRSRLAISLVEKETLFRDLYKVEY
PTLEQELDKLFALGQKLIKYTADTFSIIDQAITAGKNIVYEGAQGVLLDVDYGTYPFVTS
SNTSVAGVYSGAATAGHILDHVIGITKAYTTRVGEGPFPTELFDDVGKFIQHKGGEIGVT
TGRIRRCGWLDLPLLKYSAKCSNLTSIALTKVDVLSDMESLKVCIGYKYEGREIYCAYPG
IDLYKVEPILIDMEPFSIDETITKDNMPASLKTYLKTIYNHIGIPISSLAYGPSREQILF
FEDYFKKD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatatcgtaatcgtaggtgctcagtggggtgatgaaggtaaaggtaaaatagta
gatactttagctgagaaagcagattttgttgtacgctatcaaggtggcaataatgctggt
catacattggttgtaaatggtaagaagacatttcttcatctgataccttcagggatttta
catcagcatacaaaatgtgtaattggtcatggtgtggttttagatcctgttgccttagat
gaggaaattacacgtttacaagcaacaggtatagcaatctcagcagaaaatttatttgtt
tctgaatcttgtacaattattacttcttatcataagcttttagatgctgttagagaaagt
agtactagtgaaaaaataggtacaactggtaaaggtattggtccagcatacgaggacaag
gtatcgcgtaaaggtaccaagtttaagcatctatttgataaagatatattaagatcaaga
ttagcaatctctctagtagagaaagaaactttatttagagatttatataaagtcgaatat
ccaacgttagaacaagaacttgataagctttttgctttaggacaaaagcttattaagtat
acagcagatactttttcaataatagatcaagcaattacagcaggtaaaaatattgtttat
gaaggcgcacaaggcgtgcttttagatgttgattatggtacttatccatttgtgacatct
tctaatacttcagttgcgggtgtatattctggggcagcaactgctgggcatattttagat
catgtgattgggattacaaaagcttatacgacaagagttggtgaaggacctttcccaacg
gagctttttgatgatgttggtaaatttattcagcacaagggtggtgagataggtgtaaca
acaggtagaatccgtagatgtggctggttagacttacctcttttaaaatactcagcaaaa
tgttcaaacttaacatcaatagccttaacaaaggttgatgttttatctgatatggagtca
ctaaaagtttgtattggttataagtatgaaggtagagaaatatattgtgcttatcctggt
atagatctttacaaggttgagccaattcttattgatatggagccgttttctattgatgaa
actataacaaaagataatatgccagcatcacttaagacatatctaaagactatatataat
catataggtattccaatatcttcattagcatatggaccatctagagaacaaattttattc
tttgaggattatttcaaaaaggattaa

DBGET integrated database retrieval system