KEGG   Falco peregrinus (peregrine falcon): 101911072Help
Entry
101911072         CDS       T02856                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00480  Glutathione metabolism
fpg00590  Arachidonic acid metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101911072 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101911072 (GPX2)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101911072 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 101911072
NCBI-ProteinID: XP_005243412
Position
Un
AA seq 191 aa AA seqDB search
MTVPIAKSFYDLSATSLQGEKVDFNVFRGRVVLIENVASLUGTTVRDYTQLNQLQARYPR
RLVVLGFPCNQFGYQENGTNEEILNSLKHVRPGGGFEPNFTLFQKCQVNGQDTHPVFAYL
KAHLPAPADEATHLMAEPRFLTWSPVRRSDISWNFEKFLVGPEGEPFRRYSPRTPTAQLE
PDIQRLLKLAK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccccattgccaagtccttctacgacctgagtgccacctccttgcagggggag
aaggtggacttcaacgtcttccggggccgcgtggtcctcatcgagaacgtggcatccctc
tgaggcactacggtgcgggactacacccagctcaaccagctgcaagcccgctatccccgg
cggctggtcgtgctgggcttcccctgcaaccaatttggctaccaggagaacggcaccaac
gaggagatcctcaacagcctgaagcacgtgcggccagggggtggcttcgagcccaacttc
accctcttccagaagtgccaggtgaacgggcaggacacccaccccgtcttcgcctacctg
aaggctcacctgcccgcgccagccgacgaggcgacgcacctgatggctgagccccgcttc
ctcacctggagtcccgtgcggcgctctgacatctcctggaactttgagaagttcctggtg
ggtcccgagggggaacctttccggcgctacagcccccgcacgcccaccgcccagctggag
cccgacatccagcgcctcctcaagctggccaagtag

DBGET integrated database retrieval system