KEGG   Falco peregrinus (peregrine falcon): 101911197Help
Entry
101911197         CDS       T02856                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04218  Cellular senescence
fpg04370  VEGF signaling pathway
fpg04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101911197 (MAPKAPK2)
   04370 VEGF signaling pathway
    101911197 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101911197 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101911197 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101911197 (MAPKAPK2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101911197 (MAPKAPK2)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101911197 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101911197
NCBI-ProteinID: XP_013160522
Position
Un
AA seq 307 aa AA seqDB search
MLQDCPKARREVELHWRASQCAHIVRIMDVYENLYQGRKCLLIVMECLDGGELFSRIQDR
GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAVLKLTDFGFAKE
TTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISP
GMKKRIRMGQYEFPNPEWSEVSEEVKQLIRNLLKTDPTQRMTITEFMNHPWIMQSMQVPQ
TPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDSSNPLLMKRRKKANPT
EPAALPH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggactgcccgaaggcccgcagggaagtggagctgcactggagagcgtcgcag
tgcgcgcacatcgtccgcatcatggacgtctacgagaacctctaccaagggaggaagtgt
ctgctcatcgtcatggagtgcctggacggcggggagctcttcagccgaattcaagacagg
ggagaccaggccttcacggaacgggaggcttcagagataatgaagagcattggggaagcc
attcagtacctgcactcgatcaacattgcgcaccgggatgtgaagccggaaaacctcttg
tacacctccaaaaggcccaatgctgtgctaaaactcacggactttggctttgctaaagaa
accaccacgcacaactctttggccactccgtgttacacgccatactatgtggccccggag
gtgctgggcccggagaagtacgacaagtcctgtgacatgtggtccctcggtgtcatcatg
tacattctgctgtgtgggtacccccctttctactccaaccacggcctggccatctcacct
ggcatgaagaagcgaatccgaatgggccagtacgagtttcccaatccagaatggtccgaa
gtatcggaggaagttaagcagctgatacgcaacctgctgaagactgacccgacccagcgt
atgacgataacggagttcatgaaccacccctggatcatgcaatccatgcaggtgccgcag
accccgctgcacaccagccgcgtgctgaaagaggagaaggatctgtgggaggacgtgaag
gaggagatgacgagcgcgctggccaccatgcgagtggactatgaacaaatcaagatcaag
aaaatcgaagattcctcgaaccctttgctgatgaagaggcggaagaaagcaaaccccacc
gagcctgccgcgctcccccactga

DBGET integrated database retrieval system