KEGG   Falco peregrinus (peregrine falcon): 101911454
Entry
101911454         CDS       T02856                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04080  Neuroactive ligand-receptor interaction
fpg04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101911454 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101911454 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101911454
NCBI-ProteinID: XP_005236836
Position
Un
AA seq 99 aa
MAPATGQFRKRVALPSLPALGPCSTPAQAHVQRGDLLTLFLLSPGPLGQVPNGKDAENGL
IQTLVQPRGARRGAGHRPGGWRRYRRPRPRLSHKGPMPF
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctcctgccacggggcaattcaggaaacgggtggcgctgcccagcctgcctgccttg
ggcccctgcagtaccccagcccaggcccacgtgcagcggggggacctgctaacactcttc
ctgctgtccccagggccactgggccaggtgccgaatgggaaggatgcggagaatggcctc
atccaaaccctggtgcagccgcggggtgcgcggcgtggggctgggcaccggccgggcggc
tggcggaggtaccggcggccccggccccggctttcccacaagggccccatgcccttctga

DBGET integrated database retrieval system