KEGG   Falco peregrinus (peregrine falcon): 101911679Help
Entry
101911679         CDS       T02856                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101911679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fpg04030]
    101911679
G protein-coupled receptors [BR:fpg04030]
 Rhodopsin family
  Lipid
   Leukotriene
    101911679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 101911679
NCBI-ProteinID: XP_005233567
Position
Un
AA seq 336 aa AA seqDB search
MSQAEESSIHSTWNIVRSVVCIILSLSFIIGTPGNCIVIWTVCTKMKKVSPSVLLILNLA
IADVLVLITLPVWIYSFADSWVFGVIFCKILVFIIYCSMYASIFLITALSLERLMAVFYP
FTIQRYKTKEKISLIMFLIWFLSITFGISVIPFQETEETNGRLLCTCRNYSSNRQKVSYL
LLETLAGFVIPFLIICTCYVCVARRISRMTYQSKQRSERLIASIVVAFILCWFPHHLFNI
LDIISIQIELSNKELSLALDEIVGRGVYISGALVFISSCINPLLYAFAAQKFQNHLRFAK
ISKLFEQMSQTVTEEDKKKSLGAAKQEETLASTENL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagctgaggaaagcagtatccactcaacatggaatattgtgcggtcagtagtc
tgcataatactgagcttgtcgtttattattgggacccctggaaattgcatcgtcatctgg
actgtttgtacaaaaatgaagaaagtatctccttcagtcctgctgatcttaaatctggcc
attgcggatgtccttgtgctgattactttaccagtttggatttactcctttgctgactca
tgggtttttggagtcatcttctgcaaaatactggttttcattatttactgcagcatgtat
gcgagtatatttctaattacagcactgagcttggagcggttaatggctgtgttttaccct
ttcacaattcaaagatacaaaacaaaagaaaaaatttctttaatcatgttcctcatttgg
ttcctgtctattacttttggcatttctgtcattccatttcaagagacggaagaaacgaac
ggtcgactactatgcacatgtcgtaactactcttctaacagacagaaagtgtcatatctt
ttgctggagactcttgcaggttttgtaatcccttttttaattatttgcacttgttacgtg
tgtgttgcaagaagaataagcagaatgacttaccaatctaagcagcgatcagaacggctc
attgccagcattgtggtggcattcattttatgctggttccctcatcatctctttaacatc
ctagatattatttcaattcagatagaactctctaacaaggaactatctttggcactggat
gaaattgtaggcagaggagtgtacatctctggtgcacttgtattcatcagtagctgtatt
aaccctctactttatgcttttgctgcccaaaaatttcagaaccacctgagatttgccaag
atatcaaagctgtttgaacagatgagtcagactgtaacagaggaagacaagaaaaaaagt
ttgggtgcagccaaacaagaagaaactttagcaagcacagaaaatctttaa

DBGET integrated database retrieval system