KEGG   Falco peregrinus (peregrine falcon): 101912153Help
Entry
101912153         CDS       T02856                                 

Gene name
ACVR1C
Definition
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04060  Cytokine-cytokine receptor interaction
fpg04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101912153 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101912153 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101912153 (ACVR1C)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101912153 (ACVR1C)
Protein kinases [BR:fpg01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101912153 (ACVR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Pkinase_fungal Activin_recp APH
Motif
Other DBs
NCBI-GeneID: 101912153
NCBI-ProteinID: XP_005236502
Position
Un
AA seq 443 aa AA seqDB search
MLTNGREEVIKSCVSLPELNAQVFCHSSKNITKTECCYTDFCNNITLRLPVEPPSRAGAG
AVVLAVTVAVPVCVLSLAAVLVACSCQGRRCARGRAKQPNVEEPLSECNLVSSRKTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQEIVGKGRFGEVWRGKWCGEDVAVKIFSSRDER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLFDYLNRGTVAVE
GMVKLALSVASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKRNESCAIADLGLAVKHDS
VLNTIDIPQNPKVGTRRYMAPEILDDVMNMSIFESFKRADMYSLGLVYWEIARRCSVGGI
TEEYQLPYYDVVPSDPSIEDMRRVVCEQKLRPSIPNQWQSCEALRVMGRIMRECWYANGA
ARLTALRVKKTISQLCVQEDSKA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccaacgggcgggaagaggtcatcaagtcctgcgtctccctcccggagctgaac
gcacaggtcttctgccacagttccaagaacatcacgaagaccgagtgctgctacaccgac
ttctgcaacaacatcaccctccgcctgcctgttgagcctcccagcagagccggcgcggga
gcggtggtgctggcagtgacggtggcggtgccggtgtgtgtcctgtccctggcagccgtg
ctggtggcatgcagctgccagggccggcgctgcgcccgcggcagggccaagcagcccaac
gtggaggagcccctctctgagtgcaacctggtgagctccaggaagacactgaaggatctc
atctacgacatgacgacctctggctctggctctggtttacctctgcttgtacaaagaaca
atcgcaaggactattgtcctgcaggaaattgtaggaaaaggccgatttggtgaagtctgg
cgtggaaaatggtgtggggaagatgtagctgtgaaaatcttctcctccagagatgaacgg
tcctggtttcgggaggcagagatttatcagacagtgatgctgagacatgaaaacatcctg
ggctttattgcagcagataacaaggataatgggacatggactcagctctggcttgtctcc
gagtaccacgagcaagggtccctcttcgactacctgaacagaggcacggtggcggtggag
ggcatggtcaagctggcgctgtctgtggccagcggcctggcgcacctgcacatggagatc
gttggcacgcaaggcaagccggcaattgcacaccgagacctgaaatctaaaaacatccta
gtgaagaggaacgaaagctgcgccattgcggacctgggcctggcagtgaagcatgactcg
gtgctgaacaccatcgacattccccagaaccccaaggtggggacgaggaggtacatggcg
cctgagatactggatgatgtgatgaacatgagcatcttcgagtccttcaagcgtgcggac
atgtactctctggggctagtatactgggagatagcccgaaggtgctccgttggaggaatc
actgaggaataccagttgccttactacgacgttgtgccttccgatccttcgatagaagat
atgagaagggtagtttgtgagcagaagctgagaccaagtattccaaaccagtggcaaagc
tgtgaggcgctgcgagtgatgggcaggataatgcgtgagtgctggtacgccaacggtgcc
gcacggctcactgcgctgcgcgtcaagaagacgatttcacagctctgtgtgcaggaggac
tccaaagcctga

DBGET integrated database retrieval system