KEGG   Falco peregrinus (peregrine falcon): 101912586Help
Entry
101912586         CDS       T02856                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101912586 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101912586 (ABHD12B)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101912586 (ABHD12B)
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101912586 (ABHD12B)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101912586 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S15 Peptidase_S9 Lipase_3 Say1_Mug180 Cutinase
Motif
Other DBs
NCBI-GeneID: 101912586
NCBI-ProteinID: XP_005243081
Position
Un
AA seq 337 aa AA seqDB search
MLTRCLPCRGWLACCPRLRTLLLHLLLIYISVPFLIRLFPVLLTKFVYLNFLAFPFFVDF
RRPELLLNNTINLYLTTEPDVTVGIWHTVPSSRGDEAQGKDQRWYEEALADAHPIIIYLH
GNGGTRAASHRVQFLKTMGAAGFHILALDYRGYGDSSGYPTESGFTTDVLALYDWAKARS
GNSSILFWGHSLGTGIATNAARKLQEERGVQVDAVVLESPYPSIREAAAHIPISKIYRQF
PGFEYFILDSLALGNMFFCSDENVKVLTCPLLILHAEDDAVLPLHLAHKLFETARSTYKD
KTKVKFITFPKKLGLGHDYISFNPELPALVKDFLNIQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccaggtgccttccttgcaggggctggctggcctgctgtccccggctgcgcacc
ctcctcctgcacctgcttcttatctacatctccgtgcccttcctcatccgcctcttccct
gtcttgctcaccaaatttgtctacctgaacttcttggccttccccttcttcgtggacttt
cggcggccagagctgctgctgaacaacaccatcaacctgtacctcaccactgagccagac
gtcacggttggcatctggcacacggtgccgagcagcagaggggacgaggcgcagggcaag
gaccagcgctggtatgaggaggcacttgccgacgctcaccctatcatcatctacctgcac
ggcaatgggggaaccagggctgcgagccaccgtgtccagttcttgaagacgatgggggct
gctggattccacatcctggctctcgactacagaggctatggggactccagcgggtacccc
acagagagcggctttaccacagatgtcctggcactctatgactgggccaaagcgcggagc
gggaacagcagcatccttttctggggacactccttggggacagggattgccacgaatgca
gcaagaaaactgcaggaggagcgaggggtccaggttgatgctgttgtcctggagtcaccg
taccccagcatccgcgaagcagctgcccacatccccatcagcaagatctaccgccagttc
ccgggttttgagtacttcatcctggactcgctagctctgggcaacatgttcttctgcagc
gatgagaatgtgaaggtgctgacctgcccgctcctcatcctgcacgctgaagatgatgct
gtcctgcctctgcacctggcccacaagctctttgagaccgctcgcagtacctacaaggac
aaaaccaaggtgaagttcattacctttcccaaaaagctgggcctgggccacgactacatc
tcattcaacccagagctgcccgccctggtgaaagacttcttgaacattcagtga

DBGET integrated database retrieval system