KEGG   Falco peregrinus (peregrine falcon): 101913079Help
Entry
101913079         CDS       T02856                                 

Gene name
ERLIN2
Definition
(RefSeq) ER lipid raft associated 2
  KO
K23341  erlin
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101913079 (ERLIN2)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101913079 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 101913079
NCBI-ProteinID: XP_005233575
Position
Un
AA seq 283 aa AA seqDB search
ISLQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNK
IHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTTMAPGLIIQAVRVTKPNIPETI
RRNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKIAQVAEITYGQKVMEKETE
KRISEIEDAAFLAREKARADAECYTAMKVAEANKLKLTPEYLQLMKYKAIAANSKIYFGK
DIPNMFMDYAGSQTKFAEGLAEGIQEEDGAGTSEDTKLLHNTN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atctctcttcagaccacgctgcagacagatgaggtgaaaaacgttccttgtggtaccagt
ggtggagtgatgatttacttcgacagaattgaggtggtgaatttcctcatccagagtgca
gtatatgacatagtgaagaactacaccgctgactatgacaaagctctcatcttcaacaag
attcaccatgagctgaaccagttctgcagtgtccacacgctgcaggaggtctacatcgag
ctgtttgatcagattgatgaaaaccttaaactggccttgcagcaagacctaactaccatg
gcccctggattaattatacaggcagttcgagttacaaagccaaacatccctgaaacaatc
cggaggaattatgagctcatggagagtgagaagacaaagctgctgattgcagcacagaag
cagaaggtggtggagaaggaagcggagacagaaaggaagaaagctctcatcgaggcagag
aaaatagcacaagttgctgaaataacttacggacagaaagtgatggaaaaggaaacagag
aagcgaatttcagagatcgaagatgctgcatttcttgcgagagagaaggcaagagctgat
gctgaatgctacactgctatgaaagtagctgaggctaacaagctgaagttaactcctgag
tacttgcagctgatgaaatacaaggctatcgcagcgaacagcaagatatattttggtaaa
gatattcccaacatgttcatggactatgcaggaagccagaccaaatttgcagagggactg
gcagaaggaatccaagaagaggatggggcaggaaccagtgaggacacaaaactacttcat
aataccaactga

DBGET integrated database retrieval system