KEGG   Falco peregrinus (peregrine falcon): 101913274Help
Entry
101913274         CDS       T02856                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate-CoA ligase ADP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00020  Citrate cycle (TCA cycle)
fpg00640  Propanoate metabolism
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
Module
fpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101913274 (SUCLA2)
   00640 Propanoate metabolism
    101913274 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101913274 (SUCLA2)
Enzymes [BR:fpg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101913274 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101913274 (SUCLA2)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101913274 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 101913274
NCBI-ProteinID: XP_005240308
Position
Un
AA seq 405 aa AA seqDB search
MSMGLLQEAGISVPHGLVARTPDEAYKIAKEIGSKDLVVKAQVLAGGRGKGTFEGGLKGG
VKIVFSPEEAKDISSKMIGKKLFTKQTGEKGRICNQVFICERRYPRREYYFAITMERSFQ
GPVLIGSSQGGVNIEDVAAENPDAIIKEPIDIVEGIKKEQAVRLAQKMGFPPNLVDEAAE
NMVKLYNLFLKYDATMIEINPMVEDASGVVMCMDAKINFDSNSAYRQKKIFDMQDWTQED
QRDRDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVQQVT
EAFKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLDLKIPIVVRLQGTRVDDAKA
LITASGLKILACDDLDEAAKMVVKLSEIVTLAKQAQVDVKFQLPI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgggactgttgcaggaggctggcatttctgttccacacggactggttgccagg
acaccagacgaagcttacaaaatagcaaaagaaataggttcaaaggatcttgtggttaaa
gcacaggttttagctggtggtagaggaaaaggaacatttgaaggtggcctcaaaggagga
gtgaaaatagttttttctccagaagaagcaaaagatatctcctccaaaatgattggaaag
aagttgtttaccaagcagacaggagaaaagggcaggatatgcaatcaagtatttatctgt
gagcgcagatatcccaggagagaatactattttgcaataacaatggaaaggtcttttcaa
ggtcctgtgctgataggcagttctcagggtggtgttaatattgaagatgttgctgcagag
aatcctgatgcgataattaaggaacccattgatatagtagaaggcataaaaaaggagcaa
gctgttaggcttgcccaaaaaatgggatttcctcctaatttggtggatgaagcagctgaa
aatatggtcaaattatataatctcttcctgaaatatgatgctactatgatagaaataaat
cctatggttgaagatgcatcaggagttgtgatgtgtatggatgctaaaataaactttgac
agtaattcagcctatcgtcagaagaagatctttgatatgcaggattggacacaagaagat
caaagagacagggatgctgcaaaagcagatctcaactatataggattggatggaaacata
ggctgcttagtcaatggtgctggcttagctatggccacaatggatataattaaacttcac
ggcggaactccagcaaacttccttgatgttggtggtggtgctacagtgcagcaagtgaca
gaagcctttaagcttattacctctgataaaaaggtactggctattctggtaaatatattt
ggtggcattatgcgatgtgatgtgatagcacaaggtatcgttatggcagtaaaggatttg
gacctaaaaataccaattgtggtacggttgcaaggtacacgagttgatgatgccaaggct
ttaataacagctagtggcctcaaaatccttgcgtgtgatgacttggatgaagctgcaaaa
atggtggtgaaactctctgaaatagtaaccttagcaaaacaagcacaggtggatgttaaa
tttcagttgcccatttga

DBGET integrated database retrieval system