KEGG   Falco peregrinus (peregrine falcon): 101913488Help
Entry
101913488         CDS       T02856                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpg02000]
    101913488 (SLC4A1)
   04147 Exosome [BR:fpg04147]
    101913488 (SLC4A1)
   04090 CD molecules [BR:fpg04090]
    101913488 (SLC4A1)
Transporters [BR:fpg02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   101913488 (SLC4A1)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101913488 (SLC4A1)
CD molecules [BR:fpg04090]
 Proteins
  101913488 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 101913488
NCBI-ProteinID: XP_013153400
Position
Un
AA seq 977 aa AA seqDB search
MEVPGQELYEERMRRSLEPEGYEDIGIKGYRLSLGEMSGAGTGTASPLHVWRARAEELTP
LCQYLPGRRGYYDVDGRRRAAGAPPGQASHRGGGQPPSVTDVDVEAAGSRTLLSQQDTHE
VYVELHELVMDSTKELCWMEASHWLQLEEDFKEAGHWGQPHLSFLTYHSLLEVRRALAKG
AVLVDVAAKSLAAIAHVLIDQMIYEGQIKPQDQEAILRMLLLKHKHPDEVESVGTLLRAQ
LQRSGMGQAETEQPVLQQPLEMRRLPGAKQSPSGATKPQLPEKVPKDAEATLVLVGCAAF
LEQPTLAFVRLKDAVMLDAVLDVPLPVRFLFVVLGPDSPHISYHEIGRAVATMMSERVFR
RDAYLAEGRQDLLQGVEDFLEASIVLPPTETPNEQLLRSLVPLQQDLLRRRYQPPKKALH
KDVPKGPWAEAPPAEDDDPLRRTGKPFGGLVRDICRRYPKYLSDIKDAFSPQCLAAIIFI
YFAALSPAITFGGLLSEKTKGMMGVSELLISTCVQCVLFSFFSAQPLLVVGFSGPLLVFE
EAFYSFCSNNGIEYIVGRVWIGFWMILLVLVVVACEGSFLVRYLSRYTQEIFSFLISLIF
IYETFSKLVTIFQNHPLQRHYNVQATVQPHVPEPNTALLSLVLMAGTFFLAFFLRKFKNS
SFLPGKIRRLIGDFGVPISIFVMALVDFFIKDTYTQKLKVPKGLEVTNASARSWFIHPLG
NNSPFPIWMMFATMVPALLVFILIFLETQITTLIVSKPERKLVKGSGFHLDLLLIVVMGG
LAALFGMPWLSATTVRTITHANALTVMSKTSAASEKAQILEVKEQRVSGFFVAVLIGVSI
LMEPILKYIPLAVLFGIFLYMGVTSLFGIQLFDRILLLLMPPKYHPKEPYVTRVKTLRMH
LFTVTQIIVLVLLWVVKSTPASLALPFVLILTVPLRRLLLPKIFHEVELKCLDADDAVVT
FEEEEGTDVYDEVQMPS
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcccggccaggagctctatgaggagaggatgaggaggtccctggaacctgaa
ggctacgaggatatcggcataaagggctaccgcctatcgctgggggagatgagcggggcc
ggcaccggcaccgcgtcccccttgcacgtgtggagggcccgagctgaggagctgacgccc
ctgtgccagtacttgcctggccgccggggatactatgacgtggatgggaggaggcgtgcg
gccggggcccccccaggacaggcgagccaccgtggcggagggcagcctccatcagtgact
gatgtggatgtggaggcggcagggagcaggacgctcttgtcccagcaggacacccatgag
gtctatgtggagctgcatgagctggtcatggacagcacgaaggagctgtgctggatggag
gccagccactggctccagctggaggaggacttcaaggaagctgggcactggggccagccc
catctctccttcctgacctaccacagcctcctggaggtccgacgggctttggccaaaggt
gctgtccttgttgatgtggcagccaagtcgctggcggccattgcccatgtcctcatcgac
cagatgatctacgaggggcagatcaagccgcaggaccaggaggccatcctgaggatgctg
ctgctgaagcacaaacaccccgacgaggtggagtcagtcgggaccctgctgcgggcacag
ctgcagcgctcgggcatgggccaggcagagactgagcagcctgtgctgcagcagcccctg
gaaatgcgcaggctgcccggggccaagcagagcccgagtggggccacgaaaccgcagctc
cccgagaaggtccccaaggatgctgaggccacgctggtccttgtgggctgcgcagccttc
ctggagcagccaacgctggcctttgtgcgcctgaaggacgcagtgatgctggatgccgtc
ctcgatgtgcccctacccgtgcgcttcctcttcgtcgtcctgggccccgacagcccccac
atcagctaccacgagattggccgtgctgtcgccaccatgatgtccgagagggtctttcgc
cgggatgcctacctggctgagggccgccaggacctgctgcagggggtggaggacttcctg
gaggccagcatcgtcctgccacccaccgagacccccaacgagcagctgctgcgcagcctg
gtgccgctgcagcaggacctgctccgccgccgctaccagccccccaagaaggcgctgcac
aaggacgttccaaaaggcccatgggcggaggcaccaccagcagaggacgacgaccccctg
cgcaggacggggaaaccttttggggggctggtgcgggacatctgccgccggtaccccaag
tatctcagcgacatcaaagatgccttcagcccccagtgcctggctgccatcatcttcatc
tacttcgccgcactgtcacctgctatcacctttggaggcttactgagtgagaagaccaaa
ggcatgatgggggtgtcggagctgctcatctccacctgcgtgcagtgcgtcctcttcagc
ttcttcagcgctcagcccctgcttgtcgttggcttttcagggcccctcctcgtctttgag
gaagccttctactcgttctgcagcaacaatggcatagagtacatcgtgggccgggtctgg
atcggcttctggatgatcctgctggtgctggtggtggtggcctgcgagggcagcttcctg
gtgcgctacctgtcccgctacacccaggagatcttctccttcctcatctccctcatcttc
atctacgagaccttctccaagcttgtcacgatcttccagaatcatccgctacagcggcat
tacaatgtgcaggccacggtccagccccacgtgccagagcccaacacggcactgctgtcc
ctcgtcctcatggctggcaccttcttcctggccttcttcctccgcaagttcaagaacagc
tccttcctgcctggcaaaatccggcgtttgatcggggacttcggggtgcccatttccatc
tttgtcatggcgctagtcgacttcttcatcaaggacacgtacacgcagaaactgaaggtc
cccaaagggctggaggtcaccaacgcgtctgcccggagctggtttatccaccccttgggg
aataacagccccttccccatctggatgatgtttgccaccatggtgcctgccctcctggtc
ttcatcctcatcttcctcgagacacagattaccaccctcattgtcagcaagcctgagagg
aagctggtgaagggctctggcttccacctggacctgctgctgattgtggtcatggggggg
ctggccgccctcttcggcatgccctggctcagtgccaccaccgtccgcaccatcacccat
gccaacgccctcaccgtcatgagcaagacctccgctgccagcgagaaggcccagatcctg
gaggtcaaggaacagcgtgtcagcggcttcttcgtggctgtgctcatcggtgtctccatc
ctcatggagcccatcctgaagtacatcccgctggccgtgctctttggcatcttcctctac
atgggtgtcacctccctctttggcatccagctctttgaccgcatcctgctcttgctgatg
ccacccaagtaccaccctaaggagccctacgtcacccgggtgaagactttgcggatgcac
ctcttcaccgtcacccaaatcatcgtccttgtgctgctgtgggtggtgaagtccaccccg
gcctcgctggcgctacccttcgtcctcatcctcactgtgcccctgcggcgccttctgctg
cccaagatcttccacgaagtcgagctcaaatgtctggatgcggacgatgccgtggtgacc
ttcgaagaggaggagggcacagatgtgtacgacgaggtgcagatgcccagctaa

DBGET integrated database retrieval system