KEGG   Falco peregrinus (peregrine falcon): 101913510
Entry
101913510         CDS       T02856                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fpg01009]
    101913510 (AKAP5)
Protein phosphatases and associated proteins [BR:fpg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101913510 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 101913510
NCBI-ProteinID: XP_005241889
Position
Un
AA seq 525 aa
MVKAAKEIQMENPREAETHSTGATCSPSEERAEKPSMLCFKKRKKSCKKGLALKDVCEGA
SEEKSQCVSADQGEAKVSHQSRSSKGAWAAIKSLARPQRKQKSSSRKKVPSDSQVRLEVD
AEEGCVQGFPKKRASSRVKMPCVRFSRGKKKPSPSEAVEESEGSVQANEVMGISKKTSEE
PEDLAPADKSESFSPISAEEDQDTAKESANSVGKTEPLTEPTLDAEEEDRDTAEESADSV
GKSQPLTEPTPDAEDQDTAKESADSVGKSQPLTEPAPDAEEHTDAEEHTECTAQSEITDS
ETVNETAQEKLQEESRPQTTACAEGGQVAPEPPVPKDQPSSTPETTELQEIPSIHKELPE
GDGSEKSIILPEERKAEETVMDFSQSAFKDDAGSLQGCSSHQVTLEANVGAGVSIVITVT
EAEDSDNTDSDQAYEPSPVLHRNKQKGNKKSSRSFDFGKKEGPEAGGDPQAEEKGLGDQG
HRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaggaaattcaaatggagaacccaagagaggcagagactcacagc
acaggggcaacgtgctccccgtcagaggaacgggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctggccttgaaggatgtgtgtgaaggagcc
tcagaggagaaaagccaatgtgtcagcgctgaccaaggggaggcaaaagtttctcatcag
tcgcggtcctcgaaaggagcctgggcagccatcaaaagcctcgcaagacctcagaggaag
cagaaatcctcatcgcgaaagaaggtgccctccgattcccaagtgcggctggaggtggat
gctgaggagggctgtgtgcaaggcttcccaaagaaacgggcaagctcgagggtgaagatg
ccctgtgtacggttctccagaggcaagaaaaaacccagcccctctgaagcagtggaggag
tcggagggcagcgttcaagcaaatgaagtgatgggcatttcaaagaaaactagtgaagaa
ccggaggatttggccccagcagacaagtctgaatccttcagcccaatctctgcagaggag
gaccaggatacagcaaaggaaagtgccaactctgttggaaaaactgagcccttgacagag
cccacacttgatgcagaggaggaggaccgggatacagcagaggaaagtgctgactctgtt
ggaaaaagtcagcccttgacagagcccacacctgatgcagaggaccaggatacggcaaag
gaaagtgccgactctgttggaaaaagtcagcccctgacagagcccgcacctgatgcagag
gagcatacagatgcagaggagcatacagagtgtaccgctcagtcagagataactgattca
gagacagttaatgaaacagcccaggaaaagctgcaggaggagagccgaccccagaccaca
gcatgtgcagaaggcgggcaggttgctcccgaaccacccgttcccaaggatcaacccagc
agcacccctgaaaccaccgagctgcaggaaatccccagtatccacaaagagctgcccgaa
ggggatggatcagaaaaaagcataattcttcctgaggagcgcaaagctgaagagactgtg
atggatttcagtcagtcagcatttaaagatgatgcagggagtctgcagggctgctccagc
catcaggtgacattagaagcaaatgtgggcgccggcgtcagcattgtcatcaccgtcacc
gaagctgaggactctgacaacaccgactccgaccaggcctatgaaccgtccccagttttg
caccgaaataagcaaaaagggaataaaaaatcaagcaggagctttgattttggtaaaaaa
gagggccctgaggctggtggcgacccccaggcagaggagaaaggtctgggtgaccagggg
cacagaactggggagcagtatgaattgctcctcatagaaaccgcgtcttccctggtgaag
gcggccattcagtcatccatagagcagctggtcaacgaaatggccctggaacagaataaa
cacaacagttttctgtga

DBGET integrated database retrieval system