KEGG   Falco peregrinus (peregrine falcon): 101913588Help
Entry
101913588         CDS       T02856                                 

Gene name
ACADS
Definition
(RefSeq) acyl-CoA dehydrogenase, C-2 to C-3 short chain
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00071  Fatty acid degradation
fpg00280  Valine, leucine and isoleucine degradation
fpg00410  beta-Alanine metabolism
fpg00640  Propanoate metabolism
fpg00650  Butanoate metabolism
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
fpg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101913588 (ACADS)
   00650 Butanoate metabolism
    101913588 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101913588 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101913588 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101913588 (ACADS)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     101913588 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 DUF743
Motif
Other DBs
NCBI-GeneID: 101913588
NCBI-ProteinID: XP_013151195
Position
Un
AA seq 450 aa AA seqDB search
MSLAAEKQQPSLWCLRMFTPLLRGFRKNIQKSEMNEEGGGGGEAGKNGPSFLSALAFGCL
RRLHTVYQTAELPETHQMLRQTCRDFAEKELMPLAAQLDKEHRFPAEQVKKMGGLGLLAM
DVPEEYKGAGLDYLAYSIAVEEISRGCASTGVIVSVNNSLYLGPILKFGSEEQKHKWITP
FTDGEKIGCFALSEPGNGSDAGAASTVARLDGDEWVLNGTKAWITNAWDASATVVFATTD
KSLKHKGISAFVVPMPTAGLSLGKKEDKLGIRASSTANLIFEDCRIPKANLLGQLGMGFK
IAMQTLDAGRIGIASQALGIAQAALDCAVNYAEKRMAFGSPITKLQAVQFKLADMAVALE
GARLLTWRAAMLKDNGKPFTKEAAMAKLAASEAATAIAHQAIQILGGMGYVTEMPAERHY
RDARITEIYEGTSEIQRLVIAGQLLKAYRS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgctgcagagaagcagcagccttctctctggtgcttgaggatgtttactcca
cttctccgagggttcaggaagaacattcagaagtcagaaatgaatgaagaaggtggtggt
ggtggtgaagcaggaaagaacggcccttcgttcctttcagcactggccttcgggtgcctc
cgccggctgcacaccgtgtaccagaccgcggagctgcccgaaacccaccagatgctgcgt
cagacgtgccgggacttcgccgagaaggagctgatgccgctggccgcccagctggataag
gagcaccgcttcccggccgagcaggtgaagaaaatgggtggcttagggctgctggctatg
gatgtccccgaggagtacaaaggagcaggcctcgactatctggcctattccattgccgtg
gaggagatcagcagaggctgcgcgtccacgggcgtcattgtcagcgtcaataattctctg
tatttagggccaatactcaagtttggctccgaagagcagaagcacaaatggatcactccc
ttcactgacggagagaaaattggatgttttgcccttagtgaaccaggaaatggcagcgat
gcgggtgcggcatccacagtagcacgcctggatggtgatgagtgggttctgaatggcacc
aaggcctggatcaccaacgcctgggatgcctcggccactgtggtgtttgctactacagat
aaatccctgaagcacaagggcattagtgcatttgtggttcccatgccaactgctgggctg
tcactgggaaagaaggaggacaagctgggaatccgagcctcttcaactgccaacctgata
tttgaggactgtcggatacccaaggccaacctactggggcagctgggaatgggcttcaaa
atcgccatgcaaactctggatgcaggaaggattggtatcgcctcacaggctcttggaata
gcacaggcagctctggactgtgctgtgaattatgctgaaaagagaatggcctttgggtca
cccatcacaaagctacaggcagtgcagtttaagctagcagatatggctgtggcattggag
ggtgcacgcttgctgacctggagagccgcaatgttgaaagacaatggaaagcccttcaca
aaggaagcagcaatggccaaactggctgcatcagaagctgcaacggccatagctcatcag
gccatccagatcttgggcgggatgggctacgtgacagagatgccagcagaacgccattac
cgtgatgctcgtatcaccgagatctatgaggggaccagtgagatccaaagactggtgata
gcaggccagttgctgaaggcctaccgtagctga

DBGET integrated database retrieval system