KEGG   Falco peregrinus (peregrine falcon): 101913911
Entry
101913911         CDS       T02856                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fpg03021]
    101913911 (AFF3)
Transcription machinery [BR:fpg03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101913911 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int MACPF
Other DBs
NCBI-GeneID: 101913911
NCBI-ProteinID: XP_013160825
Position
Un
AA seq 1237 aa
MCLARDKYGINPKNLRHLVYEPDRNVLRRKEWERRNQETQQEDGAFNMSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKPDEHLIADSRPPP
PPPISSTTSSTPAALSAQQSKSTTMGWQKAGHNATSDGQQRASKHGHRSLESHKGDFKLV
NQKSSLEKLKRYASSPTSSSSNTAQQSSLRATLGDNVNRVQQPAKLNCSSEGGAQAQERP
AKHGGGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKLPAETTKSYRGV
PSNKPDSSRTKSKIAKFSIPKQEEDSGTGDNSCIEEILREMTHSWPPPLSAIHTPGKAEQ
SKFPFPNKESQQGSTGHSNTRKSDVEPKSPEKNATHASMLEDDLKLSSDEEENDQQAAQR
SALRVLSDSSLVVPQSNTRAPGLSSKGSSSSSSSESETSSESDSESESSSSESDGSKPSH
YSSPEPEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAHPYYGRVKAERQESEKTLA
TGPAEHRSGESRVATAATTVGDGPRPRTANKAPGSKGSRQKSPPAADGGPPRRAAGKKVP
RRAERASAGDSAHCPSTEEPPGSHSFPEGTAGEAPRARPGGSSSGSGGCRAGHRREPRSA
TAGEKRRARGPGKKAPKSKEFIETESSSSSSSSDSGSESEREERPLPKVPAVAGSEPRAK
DAGTGTANKPHGGCSAFGSINARTSSEIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSL
WVNIDLALLSRIPERLPEEPLAMSAGANQAASLPQGSSADPPAEKGLPKSRRKRKCENEE
ECRDIKKTHLERESSSRLAASAQSITAANHCNMNENSLAIPINKNEKMLRSPISPLSDAS
KHKYSNDDLTSSSRPNGSSLLPSISSTKKHKGEIQPQPHSGDFNKAIHVNSENVLLCNKP
QSQTEPWSPLSSTPRDCRRTKLIFDDMPRNADYFMQEAKRKKHKADAMVEKFGKALNYAE
AALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSGPSATPEDKQLAALCYR
CLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSPWGASGKSTGTPSPMSPSPSP
VSSVGSQGSTGAPSPSPIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFF
NDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3714 nt   +upstreamnt  +downstreamnt
atgtgtcttgctcgtgacaagtatgggataaatccaaaaaacctcaggcaccttgtctat
gagccagatagaaacgtgctgcgaaggaaagaatgggaaagaagaaatcaggagacccag
caggaggatggcgcgtttaacatgagttactccctcttcagtgaaccgtacaagactaat
aagggggatgagctctcgaatcgcatccagaacaccctgggcaactatgatgaaatgaaa
gacttgttaactgaccgatcaaaccagagtcaccttgttggggttccaaaacctggggtt
cctcagacgtctctccccaagcccgatgaacatcttattgcagactccagaccaccgcct
cctcctcccatttcaagcactacttcttccacaccagcagccctatctgcccagcagagc
aaaagcaccacgatgggttggcagaaggcggggcacaatgccacttcagatggccagcag
agagcaagcaagcatgggcaccggtcactggagtcacacaagggtgacttcaaactggtg
aaccagaaatccagtctggagaaactaaaacgctatgcatcgagtcccacctcttcctcc
tccaatactgcccagcaaagctcgctgagagccacactaggagacaatgtcaacagagtg
cagcagccagcaaagctcaactgtagctcggaaggaggagctcaagcacaagagaggccg
gcaaagcatggtggcgggcactgcgttcaaaacttcccaccctcgcttgcttcgaagccc
agcctggttcagcaaaaaccaacagcttatgtaaggccaatggacggtcaagaccaggct
cctgatgagtctccaaagctgaagctaccggcagagacaaccaagtcatataggggagtg
ccttctaataagcctgattcgtccaggaccaagtcaaagatagccaagttcagcattcct
aagcaagaagaggacagtggaacaggagataacagctgcattgaagaaatattgcgggag
atgacccattcatggcccccaccgttatcagctattcatacaccaggaaaggcagaacaa
agcaagtttcccttcccaaacaaggagtcacaacagggatctacaggacacagcaataca
aggaaaagtgatgtagagccaaagagtccagagaaaaacgcaacccatgcatcaatgcta
gaagatgacctcaagttaagcagtgacgaagaagagaatgaccagcaggcagcacagaga
tctgctctccgcgttctatctgacagcagcctggtggtgccgcagtccaacaccagagcc
ccaggactctccagcaaggggtcgagcagcagcagctccagtgaatcggagaccagctca
gagtctgactcggagagtgaaagcagctccagtgaaagtgacggcagcaagccctcgcat
tattccagcccagagcctgagccaccctcatccaacaagtggcagctggacaagtggttg
aataaagtcaccccgcacaaagcacccatcctgacccaccatgatggcccggcgctggag
gctcatccctactatggccgtgtgaaggcagagcggcaggaaagcgagaagaccctggcc
accggcccagccgagcaccgcagtggggagagccgcgttgccaccgccgccaccaccgtc
ggggacggaccacggcccaggaccgccaacaaagcaccaggcagcaagggcagccggcaa
aaatccccccccgccgccgacggcgggcctccaaggcgggcagcagggaagaaagtgccg
cggcgggccgagagggcctctgccggggacagcgcccactgccccagcacagaggagccc
cctgggagccacagctttccagaaggcactgctggcgaggcaccaagggcccggcccggc
ggcagcagcagtggcagcggtggctgcagagcaggacatcgccgggagccccgctcagcc
acagccggcgagaagcgtcgggcccgggggccgggcaaaaaggcacccaaatcaaaagag
ttcatcgagactgagtcttcgtcctcatcatcctcctccgactcgggctctgagtccgag
cgggaggagcgcccgctgccaaaggtgccggcggtggccgggtccgagccgcgtgccaag
gatgcggggactggcaccgccaacaaaccccacggcggctgcagtgcctttggctccatt
aatgccaggactagtagtgaaatagcaaaggagctggaggaacagttttacaccctagtt
cctttcggtaggaatgagctcctgtctcctctgaaagacagtgatgaggtaaaatcgctg
tgggtcaacattgacttggctcttttgtccaggattccagagcgtttgcccgaagagccg
ctggccatgagcgccggagcaaaccaagcggccagcctcccgcagggtagtagtgctgac
cccccagcagagaagggtttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaa
gagtgcagagacatcaagaagactcacttagagcgagagagttcttcacgattagctgcc
tctgctcaaagcatcacagcagcaaatcactgcaatatgaacgaaaatagcttggcaata
ccaataaataaaaatgagaaaatgcttcggtcacccatctctcctctctctgatgcatca
aaacacaaatactccaacgatgatttaacttcctctagcagacctaacggcagcagtcta
ttaccttccatctcctccaccaaaaaacataagggtgaaatccagccacagccacattcc
ggagacttcaataaagcaattcacgtcaattcagaaaatgttcttctctgcaataagcca
cagtcccaaacagagccttggtcacctctgtccagcacgcccagggactgcagaaggaca
aagcttatctttgatgatatgccacgcaatgcagattactttatgcaggaagctaaacgg
aagaagcataaagcagatgcaatggtggaaaagtttggaaaggcactgaattatgcagaa
gcagcactatcatttattgagtgtggaaatgcaatggaacaaggcccaatggaatctaaa
tccccttacacaatgtattcagaaacagttgaactcatcaggtatgcagtgagactaaaa
acccactcaggccccagcgccacaccagaagacaaacagctggcagcattatgttaccgc
tgcctggcccttctgtactggaggatgttccgactcaagagagaccatgcagtcaagtat
tcaaaagctcttattgagtatttcaagaattcatcaaaagctgcccagaatccgtctcct
tggggtgccagtggaaagagcacaggaactccatcacccatgtcccctagcccttctcca
gtcagctctgtgggttcccaggggagcacaggggccccttctccatctcctatcatcagc
atcccgcagcgcattcatcagatggctgccaaccacgtcagtatcaccaacagcatcctg
cacagctatgactactgggagatggctgataacctggccaaggaaaacagagattttttt
aatgacctggatgcattgatgggacctatcactttgcacagcagtatggagcatttagtt
cagtatactcaacaaggacttcactgggtgcggaatagcgctcacttgtcataa

DBGET integrated database retrieval system