KEGG   Falco peregrinus (peregrine falcon): 101914024Help
Entry
101914024         CDS       T02856                                 

Gene name
MARS
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00450  Selenocompound metabolism
fpg00970  Aminoacyl-tRNA biosynthesis
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101914024 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101914024 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fpg01007]
    101914024 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpg03016]
    101914024 (MARS)
Enzymes [BR:fpg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101914024 (MARS)
Amino acid related enzymes [BR:fpg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101914024 (MARS)
Transfer RNA biogenesis [BR:fpg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101914024 (MARS)
 Prokaryotic type
   Other AARSs
    101914024 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 101914024
NCBI-ProteinID: XP_013158052
Position
Un
AA seq 701 aa AA seqDB search
MRNIVRKLKQSDVRGVPPHALPCLSPACRLQPAASAALYAQLVQGKKGAEAVEALGKLLA
HLEQNLSRRGSAYLAGATRSVADVVVWGTLFPVLQDEASLPSELRALRTWFQSMTLSEAC
KKAASSVLMPEALLEFKSYLQKQPPPRLAMERTTSNEPEEEEGAERALTEEEITAAADAW
ARGTAALPQPWQPQQPVLPVEGRRNVLITSALPYVNNVPHLGNIIGCVLSADTFARYCRL
RNWNTLYVCGTDEYGTATETKAAEEGLTPQEICDKYNAIHADIYRWFDISFDYFGRTTTP
HQTRIAQDIFQRLLARGFLLQDTVEQLRCEGCQRFLADRFVEGTCPFCSYEEARGDQCDK
CGKLINAVELKNPQCKLCRGLPVVKPTQHLFLDLPKLEGRLEPWLEQSWATGDWTANARY
ITRSWIRDGLKPRCITRDLKWGTPVPLDGFRDKDARVHPCVSPCPPPPLPTACQVELYNF
MAKDNVPFHSVIFPCSLLGAEDNYTLVNHLIATEYLNYEDGKFSKSRGVGVFGDMAKETG
IPADIWRFYLLSVRPEGQDSAFSWGDLMLKNNSELLNNLGNFINRAGMFVCKFFGGAVPD
MAAPDRVLPPDDKRLLARVTLELHQYHQLLEKVRSGLDSGGWGVWGGQSGGRDPRCPCAQ
GEAEEIAGAAPPSPQTKLGCTGQHLELCNKINCTTVYGGGV
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacatagttagaaagctgaagcagagcgacgtacgcggtgtgccgccgcacgca
ctgccctgcctgagccctgcgtgtcgcttgcagccggcggcctcggcggccttgtatgct
cagctggtgcagggcaagaagggagcggaggcggtggaggccctggggaagctgctggct
cacctggagcagaacctgtccaggagaggctctgcctacctcgccggggccaccaggtca
gtggcggacgtggtggtgtggggcaccttgttccctgtcctgcaggatgaggccagcctg
ccaagtgagctgcgggcgctcaggacctggttccagagcatgacgctttctgaggcctgc
aagaaagccgccagctccgttctgatgcccgaggcgctgctggagttcaagtcgtacctg
cagaagcagcctccaccccgcctggccatggagagaaccaccagcaacgagcccgaggag
gaagaaggtgccgagcgtgctctgacggaggaggagatcaccgctgctgcagacgcttgg
gcccgcggcaccgcggcgctgccccaaccctggcagcctcagcaacctgtgctgccggtg
gagggcaggaggaacgtcctgatcaccagcgcgctgccctacgtgaacaacgtgccgcac
ctcggcaacatcatcggctgcgtcctcagcgccgacacctttgccaggtactgccgcctg
cggaactggaacacgctgtacgtgtgtggcacggatgagtacggcacagccactgagacc
aaggcggcagaagaggggctgacgccccaggagatctgcgacaagtacaacgccatccac
gctgacatctaccgctggtttgacatctccttcgactacttcggccgcaccaccacaccg
caccagaccaggattgcccaggacatcttccagcgcctgctggcccgcggtttcctgctg
caggacacggtggagcagctgcggtgtgagggctgccagcggttcctggccgaccgcttc
gtggagggcacctgccccttctgcagctacgaggaggcacgaggggaccaatgtgataaa
tgtggcaaactcatcaatgctgtggagctgaagaacccgcagtgcaaactctgcagggga
ctccccgtggtgaaacccacccagcacctcttcctggacctgcccaagctggaggggcgg
ctggagccctggctggagcagtcctgggccacgggggactggacggccaacgctcgctac
atcactcgctcctggatccgggatggcctcaaaccccgctgcatcacccgtgacctcaag
tgggggacccccgtgccccttgatggcttccgtgacaaggacgccagggtccacccatgt
gtgtccccgtgtccccccccgcctctccccactgcgtgtcaggtggagctttacaacttc
atggccaaggacaacgtccccttccacagcgtcatcttcccctgctcgctcctgggcgcc
gaagacaactacaccctggtgaaccacctcatcgctacagagtacctgaactatgaggac
gggaagttttccaagagccggggtgtgggggtctttggggacatggccaaggagacaggc
atcccggcggacatctggcgcttctacctgctgtccgtgcggcccgaggggcaggacagc
gccttctcctggggcgacctcatgctcaagaacaactctgagctcctcaacaacctgggc
aacttcatcaacagagctggcatgttcgtgtgtaagttcttcggcggcgccgtccccgac
atggctgcccccgacagggtgctgccgccggacgacaagcggctcttggctcgtgtcacc
ctggagctacaccagtaccaccagctgctggagaaagtccggtcagggctggattctggg
ggttggggggtgtggggggggcagagcggggggcgagacccccgatgtccctgtgcccaa
ggggaggcggaagaaatagcgggagcagccccaccctccccccagaccaaactgggctgt
actggtcagcacttagagctgtgtaataaaataaactgtacaacggtgtatggaggtggc
gtgtga

DBGET integrated database retrieval system