KEGG   Falco peregrinus (peregrine falcon): 101914823Help
Entry
101914823         CDS       T02856                                 

Gene name
FBP1
Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00010  Glycolysis / Gluconeogenesis
fpg00030  Pentose phosphate pathway
fpg00051  Fructose and mannose metabolism
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
fpg04910  Insulin signaling pathway
Module
fpg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101914823 (FBP1)
   00030 Pentose phosphate pathway
    101914823 (FBP1)
   00051 Fructose and mannose metabolism
    101914823 (FBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101914823 (FBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101914823 (FBP1)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     101914823 (FBP1)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101914823 (FBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 101914823
NCBI-ProteinID: XP_005240743
Position
Un
AA seq 339 aa AA seqDB search
MTDRSAFDTNVITMTRFVMEEGRRAKGTGEFTQLLNSLCTAIKAISTAVRKAGIANLYGI
AGSTNVTGDQVKKLDILSNDLVINMLKSSFSTCVIVSEENKDAVIVETEKRGKYIVCIDP
LDGSSNIDCLVSIGTIFAIYRKVSPDEPSGKDALQPGRNLVAAGYALYGSATMLVLATSA
GGVNCFMLDPAIGEFILVDRDVKIKKKGNIYSLNEGYAKYFDPAVTEYLKKKKFPEDGSS
PYGGRYIGSMVADVHRTLVYGGIFLYPANSKSPKGKLRLLYECNPMAFIIEKAGGIATTG
HQAILDIVPEDIHQRVPIVLGSHDDVKEYLEIVKKHSAK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgttccgccttcgacaccaatgtcatcaccatgacccgcttcgtgatggag
gaaggcaggcgggcgaaaggcaccggggagttcacacagctcctcaactctctctgcaca
gccatcaaagccatctccaccgccgtccgcaaagcgggcatcgccaacctctatggaatt
gctgggtctaccaacgtgacaggagatcaagtaaagaagttggacatcctttccaatgac
ctggtgattaacatgctcaagtcatccttcagtacgtgtgttattgtgtcagaagaaaac
aaagatgctgtgatagtggaaactgaaaaacggggtaaatacatagtctgcatagaccct
ctagatggctcatcgaacattgactgtcttgtttccattgggaccatctttgccatctat
agaaaggtgtcccctgatgaaccatctgggaaggatgctttacaacctgggcgtaatctt
gtggcagctggttatgctctctatgggagtgccacaatgctggtactggccacttctgct
ggaggtgtcaactgtttcatgctggatccggcaattggagaattcattttggtggatagg
gatgtgaaaatcaaaaagaagggaaatatctacagtctcaatgaaggctatgctaaatac
tttgatcctgcagtcacagagtatctcaagaagaagaagttccctgaggatggcagttca
ccatatggtgggaggtacataggatctatggtggctgatgtgcatcgcacgctggtgtat
ggaggaatttttctgtatcctgctaactcaaaaagtcccaaaggaaagctgagactgctt
tacgaatgcaatcctatggcttttattattgagaaggccgggggaatagcaacaactggt
catcaagcaatactagatatagtgcctgaggatatccaccaaagagtgcctattgtcttg
ggatctcatgatgatgtgaaggaataccttgagatagtcaagaagcattcagctaagtaa

DBGET integrated database retrieval system