KEGG   Falco peregrinus (peregrine falcon): 101914885Help
Entry
101914885         CDS       T02856                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101914885 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101914885 (CAMK1D)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101914885 (CAMK1D)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101914885 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH 5_nucleotid Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 101914885
NCBI-ProteinID: XP_013156805
Position
Un
AA seq 397 aa AA seqDB search
MITFQIKGISVAVRLFLLKFSNTEGHLYAAVDFGWGAFSEVVLAEERASGKLFAVKCIPK
KALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFY
TEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGD
VMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKA
EYEFDSPYWDDISESAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQ
IRKNFAKSKWRQAFNATAVVRHMRRLHLGSSLDSASASVSSTLSLATPLPDAATRKDCMS
PSTLCSFVSSASSGVSAVGGDRRPRPTTVTTVHTGSK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttcagataaagggaatcagcgttgctgtcagattgtttctgctgaagttt
tccaacacagaaggtcatctctatgcagcagttgactttggttggggtgcattctctgag
gttgttttggctgaagagagagcgagtgggaaactctttgcagtcaagtgcattcccaag
aaggcactgaagggaaaggaaagcagcatagagaatgaaattgcagtcctgagaaagatc
aagcatgaaaatatagttgccctggaagacatctatgagagtccaaaccatttatatctg
gtcatgcaattggtgtctgggggagagctttttgatcgcatcgtcgagaaagggttctac
actgagaaagatgccagcaccctgatccggcaggtcctggatgctgtctactacctgcac
cgaatgggcatcgtacacagggacctcaagcccgagaatctgctttactacagccaggat
gaagagtcaaaaatcatgatcagtgactttggattgtcaaagatggagggtaaaggagat
gtgatgtccacagcctgtgggactcctggctatgtcgctcctgaagtgctggctcagaaa
ccctacagcaaagccgtggactgctggtccatcggagtcatcgcatacatcctgctctgt
gggtatccccctttctatgatgaaaatgactccaaactctttgagcagatccttaaggcg
gagtatgagtttgactctccgtattgggacgacatctctgagtccgctaaagacttcatt
cggaatttgatggagaaggaccctaataaaagatacacctgtgagcaagcagcgcgacac
ccttggatcgctggtgatacagcgctcaacaaaaacatccacgagtcggtcagtgctcag
atccggaagaactttgcaaagagcaaatggagacaagcatttaatgccacggcggtggtg
cggcacatgagacggttacacctcggcagcagcctggacagtgcaagcgccagcgtatcc
agcaccctcagccttgccacgccgcttcctgatgcagccacacggaaagattgtatgtct
ccatccactctctgtagttttgtttcatctgcttcttcaggcgtttctgcggtaggaggg
gaccggagacccagacccaccacagtgaccacagtgcatacagggagcaagtga

DBGET integrated database retrieval system