KEGG   Falco peregrinus (peregrine falcon): 101915205Help
Entry
101915205         CDS       T02856                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-3-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00232  Caffeine metabolism
fpg00983  Drug metabolism - other enzymes
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101915205
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101915205
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101915205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101915205
NCBI-ProteinID: XP_013152525
Position
Un
AA seq 304 aa AA seqDB search
MPATTSKESGSRGSMDIKEYFARISYRGSYDKPDLATLTDIFQHHIRAVPFENLNIHCGE
RIVLDLEVTFNKIVRKNRGGWCMENNNLLSWVLKTLGYDVTLLGAKVFVPEYDAYAEEID
HLLLKVVLDNKSYIVDGGFGMACQMWQPMELVSGRDQPQTPGIFRFLEDNGVWYLEKMRR
KQCTPDGIVSTSHELEIEGRRRIYHFTLQPQDIEEFRARNNHLQTAPKSLFVLKSLCSLQ
TTDGIRSLVGWKFTEMKYNYKDNMDLVEIKILADDEIEKTLKEKFNITLDKKLVPVNRSR
LSVV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaccaccagcaaggagagcgggagcagaggcagcatggacatcaaggagtat
tttgccagaatttcttaccggggctcgtacgataagccagacctggctaccttgacagat
atattccagcaccacatccgagcagtcccttttgaaaacctcaacatccactgtggggaa
aggatcgtgctggacctggaagtgactttcaacaaaatagtgaggaagaaccgcgggggc
tggtgcatggaaaacaacaaccttttatcttgggtcctgaaaaccctcggctatgacgtc
actcttctgggagcaaaagtttttgtcccagagtatgatgcatatgcagaggaaatagat
catctgctgctaaaagtggtgcttgacaacaaatcctacattgtggatggtggctttggg
atggcctgccagatgtggcagccaatggagctggtttcgggaagagaccagccacagact
ccggggatctttcgcttcctggaggacaatggggtctggtacctggagaagatgagaagg
aagcagtgcactcccgatggaattgtctccacttcccatgagctggaaatagaaggtcgc
cgtcggatttatcactttacccttcagccacaggacattgaagagttcagagcccgcaac
aaccacctgcagacagcaccgaaatccctgtttgttctaaagtctctctgcagcctgcag
accactgacggcatccgctctcttgtagggtggaagttcaccgagatgaagtacaattac
aaggataatatggatctagtggaaatcaaaatccttgcagatgatgaaatagagaaaacg
ctgaaagagaagttcaatataacactagacaagaaattggtacccgtcaatagaagcagg
ctgtcggtggtttaa

DBGET integrated database retrieval system