KEGG   Falco peregrinus (peregrine falcon): 101915315Help
Entry
101915315         CDS       T02856                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04068  FoxO signaling pathway
fpg04310  Wnt signaling pathway
fpg04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101915315 (NLK)
   04310 Wnt signaling pathway
    101915315 (NLK)
   04068 FoxO signaling pathway
    101915315 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101915315 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101915315 (NLK)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101915315 (NLK)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101915315 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 101915315
NCBI-ProteinID: XP_005233754
Position
Un
AA seq 527 aa AA seqDB search
MSLCGTTANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttcctcacctccctcct
cctcacctccatcaccaccaccaccctcaacatcacttgcatccaggctctgcagctgcg
gtacatcccgtacagcagcatgcctcttcggcagctgcggccgcggcagctgcggccgcg
gccgcagcaatgttaaacccagggcagcagcagccatatttcccatcaccggcaccgggt
caggcccctggaccagctgcagcagccccagctcaggtacaagctgcagcagctgctgca
gttaaagcgcaccatcatcagcactcacaacatccacaacagcaactggatattgagccg
gacagacctattggatatggagcctttggtgttgtctggtcagtaacagatccacgagat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatttggtctcttgtaaa
agggtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgcc
ctcgacatactccagcctccacacattgactattttgaagaaatatatgttgtcactgaa
ttgatgcagagtgacctccataagattatcgtctctcctcagccactcagctcggatcat
gtcaaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatt
ttacatcgagacattaaaccagggaacctacttgtgaacagcaactgtgttcttaagatt
tgtgattttggattggccagggtggaagaattagatgaatctcgtcacatgactcaggaa
gttgtcactcagtattatcgagctccagaaatcctgatgggcagccgtcactacagcaat
gctattgacatctggtctgtaggctgtatctttgcagaattacttgggcgaagaatattg
tttcaggcacagagtcccatacagcagctggatttgatcacagacctgttgggaacacca
tcgctggaagcaatgaggacggcttgtgaaggcgccaaggcacatatactcaggggtcct
cataaacagccatcccttcctgtcctatatacactttccagtcaagctacacatgaagca
gttcatctcctttgcagaatgttggtctttgatccatccaaaagaatatctgctaaggat
gccttagctcacccatatctcgatgaagggcggttgcgataccacacctgtatgtgtaaa
tgttgtttttccacatctactggaagagtttatactagtgattttgaacccatcactaat
cccaaatttgatgacacttttgaaaagaacctcagttccgttcggcaggttaaagaaata
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccacggttgctcaaccatctgagatgccg
ccatctccattggtttgggaataa

DBGET integrated database retrieval system