KEGG   Falco peregrinus (peregrine falcon): 101915367Help
Entry
101915367         CDS       T02856                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04012  ErbB signaling pathway
fpg04020  Calcium signaling pathway
fpg04114  Oocyte meiosis
fpg04217  Necroptosis
fpg04261  Adrenergic signaling in cardiomyocytes
fpg04310  Wnt signaling pathway
fpg04912  GnRH signaling pathway
fpg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101915367 (CAMK2G)
   04310 Wnt signaling pathway
    101915367 (CAMK2G)
   04020 Calcium signaling pathway
    101915367 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101915367 (CAMK2G)
   04217 Necroptosis
    101915367 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101915367 (CAMK2G)
   04916 Melanogenesis
    101915367 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101915367 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101915367 (CAMK2G)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101915367 (CAMK2G)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101915367 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 101915367
NCBI-ProteinID: XP_013156439
Position
Un
AA seq 598 aa AA seqDB search
MTRRKNPKMSIVGAFSVVRRCVKKSSSQEYAAKIINTKKLSARDHQKLEREARICRLLKH
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQH
DIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDP
YGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLIN
QMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLV
SRNFSGKFSLLNKKSDGVKKRKSSSSVHLMPQSNNKTSAVSTAKETPPVQTSMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKAPPLSTGDGSSVLEGRRHSESKTQTESMQSQLSLCF
SATTQSCEEKLLAWDSPGQTLELERARSEPLLTPVVPFVLNRAPLRKQEIIKITEQLIEA
INNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVH
VIGEDAACIAYIRLTQYIDGQGRPRTTQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaagaaagaatcccaagatgtcgatagtgggagccttctctgtggtccgcaga
tgtgtaaagaaaagttcatcacaggaatatgctgcaaaaatcatcaacaccaaaaaactg
tcagccagagatcaccagaaactggaacgtgaagctcgaatctgtcgacttctaaagcat
ccaaatattgtgcggctccatgacagtatctcagaagaaggtttccattacctcgtcttt
gatctggttactggtggggagctctttgaggatattgttgccagagaatactacagtgaa
gcagatgccagccactgtattcaccagatactggagagtgtgaatcatattcaccagcat
gatatcgtgcacagggacttgaagcctgagaatttactactggcaagtaaatgtaagggt
gctgctgtcaaactggctgacttcggactggctatagaagtccagggagagcagcaggcc
tggtttgggtttgctggcactccaggctacctctctcccgaagtcttaagaaaagatcct
tatggaaaaccagtggatatatgggcatgtggagtgattctgtacatattactagtgggg
taccctcccttttgggatgaagatcagcacaaactctatcagcagatcaaagccggagcc
tatgacttcccatcacctgagtgggacactgtgactcccgaagcaaagaatttgatcaac
cagatgctgacgataaacccagcaaagcgcatcacagctgaccaggctctcaaacatcca
tgggtctgtcaacgatccactgtcgcttcaatgatgcacaggcaggagactgtggaatgc
ttgagaaagttcaatgctagaaggaagctaaaaggtgcaatcctcacaacgatgctcgtg
tctcgaaatttttcaggtaagttctcnctgctgaacaagaagtcagatggagtgaagaaa
aggaagtcgagctccagtgtgcatttgatgccacagagcaacaacaaaaccagtgcagta
agcactgcaaaagaaacacccccagtgcagacgtccatggagcctcaaacaactgttgtc
cataatgctacagatggcataaagggttccacagagagctgtaacaccacgaccgaagat
gaggatctgaaagctccccctctctccaccggggacggcagctcagtgcttgaaggacgg
aggcacagtgagagcaaaacacagactgagtccatgcagtcccagctttctctctgtttc
tcagccactacacagtcttgtgaagagaagcttcttgcctgggacagcccagggcagaca
ttggagttagagcgtgctcggtcggagcctttgctaactccagtagttccctttgtactt
aaccgcgcaccgttgcgtaagcaagagatcattaagataacagagcagctgatagaagct
atcaacaatggagactttgaggcttatacaaaaatctgtgatcccggcttgacctcattt
gaacctgaagcactggggaacctggttgaaggaatggatttccataagttttacttcgag
aacttattgtcgaagaacagcaagccgatacataccaccatcctgaacccccacgtccac
gtcatcggtgaggatgctgcctgcatcgcgtacatccgcctgacacagtacatcgacggc
caaggccggccccgcaccacgcagtctgaggagacccgtgtctggcaccgccgggatggc
aagtggctgaacgtccactaccactgctctggagctcctgcagcacctctccagtga

DBGET integrated database retrieval system