KEGG   Falco peregrinus (peregrine falcon): 101915399Help
Entry
101915399         CDS       T02856                                 

Gene name
ST3GAL6
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 6
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00601  Glycosphingolipid biosynthesis - lacto and neolacto series
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101915399 (ST3GAL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fpg01003]
    101915399 (ST3GAL6)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     101915399 (ST3GAL6)
Glycosyltransferases [BR:fpg01003]
 Terminal extension
  Sialyltransferase
   101915399 (ST3GAL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 101915399
NCBI-ProteinID: XP_005237538
Position
Un
AA seq 329 aa AA seqDB search
MKRILLFFILAAAVMYGILHGNLWRNNLYWLPPTAVERRNALGTCVLKPAFESLVGVDKI
YPFLCANDFIRVAEFHGSDKFELPYGIKRAEQFFRLALSRLQNCGLSNEDDSIACRRCVV
VGNGGVLRNKTLGEKIDSYDVIIRMNNGPVIGYEEDVGRRTTFRLSYPESIFSDPIHYDP
NTTVVLIVFKPRDLKWLWEILGGQKISAKGFWKKPALNMIYRSGQIRILDPSITRKAAYE
WLRFPIRFPKKEKPKHPTTGLIAITLAFHICHEVHLAGFKYDFTDRNSSLHYYGNDTMSQ
MMQNEYHNINAEQKFLKKLIDKNFVVNLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcttctgttttttatcttggctgctgctgttatgtatggtatactgcat
ggaaatctgtggagaaataacctctattggctgccacctacagctgtggagagaaggaat
gcactgggtacttgtgtcctgaaaccagcatttgaatctttagtgggtgttgacaaaata
tacccattcctgtgtgctaacgattttatcagagtggctgagttccacgggagcgataag
tttgaactgccttatggaataaagcgagcagagcaattttttcgtttagccctttcaaga
ctacagaactgtggactttccaatgaagatgacagtattgcctgtcgacggtgtgttgtg
gtcggtaatggaggagtgcttcgaaataagacgttaggagagaagattgactcgtatgac
gtgataataagaatgaataatggccctgttatagggtacgaagaggatgttgggcggagg
acgacttttcgcctttcttacccggaatccatcttctctgatccaatccactatgaccct
aatacaactgttgttctcattgtcttcaaaccacgtgacttgaaatggctttgggagata
ctaggtggtcagaaaataagtgctaaaggcttttggaagaaaccagctctgaacatgatt
tacaggtctggtcaaatcaggatccttgatcccagcatcaccagaaaagcggcttatgaa
tggcttcgtttcccaataaggtttcccaagaaggagaaacccaagcatccaacaacgggg
ctaattgccattacactagcatttcacatatgccatgaagttcacctggcaggcttcaag
tacgacttcactgacagaaacagttctttgcactactatggcaatgacacgatgtctcag
atgatgcagaatgaataccacaacatcaatgctgagcagaaatttctgaagaagcttata
gacaagaactttgtggtcaatttgacgtga

DBGET integrated database retrieval system