KEGG   Falco peregrinus (peregrine falcon): 101916159Help
Entry
101916159         CDS       T02856                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00561  Glycerolipid metabolism
fpg01100  Metabolic pathways
Module
fpg_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101916159 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101916159 (MGLL)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101916159 (MGLL)
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S33
   101916159 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DLH Peptidase_S9 Lipase_3 Abhydrolase_2 PGAP1 Thioesterase Abhydrolase_5 FSH1 DUF2048 DUF1350 LIDHydrolase LIP
Motif
Other DBs
NCBI-GeneID: 101916159
NCBI-ProteinID: XP_005230064
Position
Un
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPAATPRALVFIAHGAG
EHCGRYDDLAQRLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKEHP
GLPILILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPIL
VLHGSSDKLCDIKGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVSTSVFTEILTWIAQ
KVSAAGENSHT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcaccaaagcggagtcctcaa
aacatcccgtacaaggacctgccccatatcatcaatgctgatgggcagcatctcttctgc
aggtattggaagccagcagcaactcccagggccctggtgtttatcgctcacggcgctggg
gaacactgcggccgctatgatgacttggcccagaggctgacaggactcaacttgtttgtt
tttgcccacgaccatgttggccacgggcagagcgagggtgatcgtatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagagcaccct
gggctgcccattctcattctggggcactccatggggggagccatctccattctgacagct
agtgagagacccagtgagttttcaggaatgctgttaatctctcctttagtggtagccagc
ccagaagtcgccactcctatcaaggtttttgcagcgaaagtgctcaattttgttctccca
aacctgtcgctgggatcgatagatccaaatgcaatttcccggaacaagaaggagatggag
tcttacacatccgatcccttggtctaccatggcggcatgaaggtctccttcgtcatccag
ctgatgaatgccatcgccagaattgagcgagctctgcccaagctgactttgcccatcctg
gtgctacacggctcttccgacaagctctgcgacatcaaagggtcctatttactaatggac
acagtgcagagtcaggacaaaaccctcaaggtgtatgaggaagcctatcatgccctccac
aaagagctgcctgaggtttctacctctgtcttcacagaaatactaacatggatcgcccag
aaggtctcagcagctggggaaaacagccatacttaa

DBGET integrated database retrieval system