KEGG   Falco peregrinus (peregrine falcon): 101916653Help
Entry
101916653         CDS       T02856                                 

Gene name
CHRNA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101916653 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fpg04040]
    101916653 (CHRNA4)
Ion channels [BR:fpg04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   101916653 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 101916653
NCBI-ProteinID: XP_005239995
Position
Un
AA seq 617 aa AA seqDB search
MGILVSKGNLLLLLCASIFPAMKAEDRLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQ
LIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGD
FAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLV
SMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLFYTINLII
PCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLF
TMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRIFLDIVPRLLFMKRPSTVKDNCKKLI
ESMHKVTNTPRLWSEIDVEPNFATSSSSSPQSNEPSPTSSFCAHLEEPAKPQPICKSPSG
QYSVLHPEPVQVTCSSPQASCRPLGDTQTTSILKGRSLSVQQMYSPNKAEEGSIRCRSRS
IQYCYLQEDSSQTNGQSTGSPASQRYHLNEEQPQHKPPQCKCKCKKNEAAGTPAQGSKTH
SAKEQHLVLMSPALKLAVEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVC
LLGTVGLFLPPWLAGMI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgggaattctcgtgtctaaaggaaacctcctcctcctgctgtgtgccagcatcttcccc
gctatgaaggcggaagatcgtcttctgaagaaactcttctctggttataacaagtggtcc
cgtcccgtcgccaacatttcagatgtcgtactcgtccgcttcggcttgtccattgcccag
ctcatcgatgttgatgagaaaaatcaaatgatgaccacgaacgtgtgggtgaaacaggag
tggcatgactacaaactacgctgggacccccaagagtatgaaaatgtcacatccatccgc
atcccctcggagctcatctggaggccagatattgtcctctacaacaatgctgacggtgac
tttgcagttacccacctgaccaaggctcacctcttctatgatgggagaattaaatggatg
ccacctgcaatctataaaagctcctgcagcatcgatgttaccttcttcccctttgaccaa
caaaactgcacaatgaagtttggctcctggacctatgataaagccaagatagacttggtg
agcatgcacagtcatgtggaccagctggactactgggagagcggggaatgggtcatcatc
aatgctgtgggcaattacaacagcaagaaatatgaatgctgcacagagatctaccccgat
ataacttactccttcattatccggaggctgccactgttctacacaatcaatctgatcatc
ccttgcctgctgatctcctgcctgactgtcctggtcttctacctgccctctgagtgtgga
gagaagataaccttgtgcatctccgtgctgctgtccctcactgtgttcctgctgctcatc
acagagatcatcccatctacctccttggtcatccctctgattggagagtatcttctcttc
accatgatatttgttaccttgtctatcattatcactgtctttgtcctcaatgtgcaccat
cgttctccacgtacccacacgatgcctgactgggtgagaaggatcttccttgacatagtc
ccacgcctcctcttcatgaaacgtccctccacagtgaaagacaattgcaagaagctcatt
gaatccatgcacaaagtaaccaatacgccaaggctttggtccgagattgatgtggaaccc
aacttcgctacctcatcttcctccagcccccagagtaatgagccatcacccacgtcttcc
ttctgtgcccacctcgaggagccagccaagcctcagcctatctgcaagtccccttctggg
cagtactctgtgctgcacccagagcccgtgcaggtgacctgctcctctccacaagcctca
tgccgccctctgggtgacacccagaccacctccatcttgaaaggcagatcactaagtgtg
cagcagatgtacagccccaataaggcagaggaagggagcatccgctgtaggtcccggagc
atccagtattgctacctgcaagaggactcttcccagaccaacggccaatccactggttct
ccagcatcccagcggtaccacctaaatgaagagcagccccagcacaagccccctcagtgc
aagtgtaaatgcaaaaagaatgaggcagctggcacaccagcccaaggaagcaagactcac
agcgccaaagagcaacaccttgtgttgatgtccccagccctgaagttggcagtggaaggg
gttcattacatcgcagaccacctgcgagcagaagacgcggatttctcagtgaaagaagac
tggaagtacgttgcgatggtcattgacaggatcttcctctggatgttcatcattgtgtgt
ttgctgggaactgttggtctcttcctcccaccgtggctggctggaatgatctaa

DBGET integrated database retrieval system