KEGG   Falco peregrinus (peregrine falcon): 101917700
Entry
101917700         CDS       T02856                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00230  Purine metabolism
fpg00240  Pyrimidine metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101917700 (DCK)
   00240 Pyrimidine metabolism
    101917700 (DCK)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101917700 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_33 Thymidylate_kin AAA_18 DUF5066 BCAS3 AAA_17
Other DBs
NCBI-GeneID: 101917700
NCBI-ProteinID: XP_005243284
Position
Un
AA seq 240 aa
MGKRMAAAGKSTFVNILKQADEEWEVVPEPVARWCNVQQNSEKDCEELTTSQKSGGNVLQ
MMYEKPERWSFTFQTYACLSRIRAQLRSLDGKLREAENPVVFFERSVYSDRYIFAANLYE
SDCMNETEWTIYQDWHDWMSKQFGQSLALDGIIYLRATPEKCLNRIYLRGRDEEQEIPIE
YLEKLHYKHESWLQHRTLRMDFEYLQEIPILTLDVNEDFKGKKDIYDHMTEKVKEFLSTL
NT seq 723 nt   +upstreamnt  +downstreamnt
atggggaagcgcatggcagctgcagggaagtcgacatttgtgaatattctcaagcaagct
gatgaggaatgggaagttgttcctgagcctgtagctagatggtgcaatgttcagcaaaac
tctgaaaaggattgtgaggagctgaccacatcgcagaagagtggcggaaatgtgcttcag
atgatgtatgagaaaccagagaggtggtctttcactttccagacgtatgcatgcctcagc
aggatccgggctcagctgaggtcccttgatggcaaactcagagaggcggagaatcctgtg
gtcttcttcgagcgatccgtctacagtgacaggtacatctttgcagctaatttatatgag
tctgattgcatgaatgaaactgaatggactatataccaagactggcatgactggatgagt
aagcagtttggtcaaagcctagcactggatgggatcatttatctcagagccactcctgag
aaatgcttaaataggatttacttgcgtggaagagatgaagagcaagaaattcccattgag
tatctggagaagcttcattacaagcacgaaagttggcttcagcacaggacattgcgaatg
gattttgaatatcttcaggaaatacctattttaacgttagatgttaatgaagacttcaaa
ggcaaaaaggacatatatgatcacatgactgaaaaggtcaaagaatttttgagcacgtta
taa

DBGET integrated database retrieval system