KEGG   Falco peregrinus (peregrine falcon): 101917916Help
Entry
101917916         CDS       T02856                                 

Gene name
PARP3
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg03410  Base excision repair
fpg04210  Apoptosis
fpg04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101917916 (PARP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101917916 (PARP3)
   04217 Necroptosis
    101917916 (PARP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fpg03032]
    101917916 (PARP3)
   03036 Chromosome and associated proteins [BR:fpg03036]
    101917916 (PARP3)
   03400 DNA repair and recombination proteins [BR:fpg03400]
    101917916 (PARP3)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101917916 (PARP3)
DNA replication proteins [BR:fpg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101917916 (PARP3)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101917916 (PARP3)
DNA repair and recombination proteins [BR:fpg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     101917916 (PARP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 101917916
NCBI-ProteinID: XP_005234600
Position
Un
AA seq 526 aa AA seqDB search
MALKRHALALKQPDHREKKVRGGEEEDTWSSTLAALKTAPKEKPPAIIDGLCPLSTALGA
LVYEDYDCTLNQTNINANNNKFYIIQLIKHDGAYSVWTRWGRVGEVGQSKLMPYASLEAA
KKDFEKKFHEKTKNSWAARENFIAQPGKYTLIEVQSGAGQEMEVALKVDGVDRDKVCKQR
VLPCTLDKATQDLVSLIFSSDMFQDAMQTMNINVKKMPLGKLSKQQIARGFEVLEELEAA
LREQPSQAALLEDLSSRFYTIIPHNFGRARPPPINSPDLLRAKKDMLLVLADIEVAQSLQ
AQKVKEEEEVAHPLDQDYALLCCQLSLLDPASWEYQLIQNYVTQTGHKLHILNIWQVARD
GEDERFKAHDLLENRRLLWHGTNVAVIAAILKSGLRIMPHSGGRVGRGVYFASENSKSAC
YVGCTSKKVGIMFLTEVALGKPYRITCDDPTLCQPPTGYDSVLACGQTEPDPAQDQEVLL
DGRKVLVCQGKPIPMPAYKNSSFSQSEYLIYQESQCRIRYLVQLRF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggccctcaagcgccatgcattggccctgaagcagccagaccacagggaaaagaaagtg
agggggggagaggaggaagatacctggagctccaccttggcagccctgaaaactgccccc
aaggagaagccccctgccatcattgatgggctgtgccccctgagcacagcactgggtgcc
ctggtctatgaagactatgactgcaccctgaaccagaccaacatcaatgccaacaacaac
aaattctatatcatccagctcatcaagcacgatggtgcctacagtgtctggacccgctgg
ggccgtgtgggcgaggtgggccagtccaagctcatgccctacgcctccctggaggctgcc
aagaaggactttgagaagaaatttcacgagaagaccaaaaacagctgggcagcaagggag
aacttcattgcccagccggggaagtacacactcatcgaggtgcagtcaggagctgggcag
gagatggaggttgccctcaaggtggatggcgtggacagggacaaggtctgcaagcagcgg
gtgctgccctgcaccctggacaaagccacacaggacctggtgtctctcatcttcagcagc
gacatgttccaggatgccatgcagaccatgaatatcaatgtgaagaagatgccgctggga
aagctgagcaagcagcagattgcgaggggctttgaggtactggaggagctggaggcagca
ctgcgggaacagccctcccaggctgccctgctggaggacctctcctcccgattctacacc
atcatcccgcataactttgggcgggcacggccacctcccatcaactcccccgacctgctg
cgtgccaagaaggacatgctgttggtgctggctgacattgaggtggcacagagcctgcag
gcgcagaaggtgaaggaggaggaggaagttgcccatccactggatcaggattacgccctg
ctctgctgccagctctccctcctggacccagcttcctgggaataccagctgatccaaaac
tacgtgacacagactgggcacaagctccacatcctcaacatctggcaggtggcccgagat
ggcgaggatgagcgcttcaaagcccatgacctcctggagaaccggcgcctgctttggcat
ggcaccaacgtggcggtgatcgcagccatcctgaagagtgggctgcgcatcatgccccac
tcaggcgggcgtgtgggcaggggcgtctactttgcctctgagaacagcaagtcagcctgc
tatgtgggctgcacgtccaagaaggttggcatcatgttcctgacagaggtggccctgggc
aagccctaccgcatcacctgtgatgaccccacgctgtgtcagccacccaccggatacgac
agtgtcctggcctgcggccagacagagccggatcctgcgcaggatcaggaggtgctgctg
gacggcaggaaggtgctggtgtgccagggcaagcccatccccatgcctgcctacaagaac
tcctccttcagccagagcgagtacctcatctaccaggaaagccagtgccggatccgctac
cttgtccagctccgcttctga

DBGET integrated database retrieval system