KEGG   Falco peregrinus (peregrine falcon): 101918141Help
Entry
101918141         CDS       T02856                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00020  Citrate cycle (TCA cycle)
fpg00190  Oxidative phosphorylation
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
Module
fpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fpg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101918141 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101918141 (SDHB)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101918141 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101918141
NCBI-ProteinID: XP_013155899
Position
Un
AA seq 256 aa AA seqDB search
MCRGVQTAAAAAPRMKKFAIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELD
STLTFRRSCREGICGSCAMNIAGGNTLACIKRIDTDLTKTTKIYPLPHMYVVKDLVPDLS
NFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGD
KYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIA
EIKKMMATYKEKATAA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcggggagtgcagacagcagctgcggcagcgccccgtatgaagaagtttgccatt
tacagatgggatcccgataagcctggggacaagccccgcatgcagacatatgaagtggat
ttgaataaatgcggacctatggtgctcgatgctctgatcaaaataaaaaatgagttggac
tccactctgactttccgcagatcatgtagagaaggcatctgtggctcttgtgctatgaac
attgctggcggaaacacactggcctgtatcaaaagaattgacaccgatctcaccaagacc
actaaaatctaccctctcccccacatgtatgtggtgaaggaccttgtcccggacttgagc
aacttctatgcacagtacaaatccattgagccttacctgaagaagaaggatgagtcaaaa
cagggcaaggagcagtacctgcagtccatagaagaccgtcagaaactggacggactctac
gagtgcatcctgtgtgcctgctgcagcaccagctgtcccagttactggtggaacggggac
aagtacttgggtcctgcagtactgatgcaggcctatcgctggatgattgactccagagat
gactacacagaggaacgcctggcacagcttcaagacccattttctctttaccgttgtcac
actatcatgaattgcacaaggacttgccctaagggtttgaaccctggcaaagcaattgct
gagatcaagaagatgatggcaacttacaaagagaaggcgaccgctgcataa

DBGET integrated database retrieval system