KEGG   Falco peregrinus (peregrine falcon): 101919625Help
Entry
101919625         CDS       T02856                                 

Gene name
TYW3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpg03016]
    101919625 (TYW3)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     101919625 (TYW3)
Transfer RNA biogenesis [BR:fpg03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101919625 (TYW3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 101919625
NCBI-ProteinID: XP_013160367
Position
Un
AA seq 211 aa AA seqDB search
MKALEKATGDIVLKFEPFVLHVLCQELQDAQLLHSVAIESGFRNSGITVGRGGKITMAVR
STHCLEVPLSHKGKLMVSEEYIEFLIDVANQKMEENIRRIDRFYKRLELALKTAISANNS
PSEETAKSRAVYVRRRKRKTIQEQDVRTSPKDHNEALEPEDDTESSLASSVHRQLVSSLA
YCSVRPAPSLRSGCWAESQPKHTVTGSLTRL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactagagaaagccactggcgacattgtgctgaagtttgaaccatttgttctt
catgtgctatgtcaagagctgcaagatgcacagcttctgcattcagtggctattgaatct
gggttcaggaactctggtattacagttggcagaggaggaaaaattacaatggctgtccgg
agcactcattgcttagaagttccattgagccacaaggggaaattgatggtctctgaagaa
tatattgaatttctgatagacgtagctaatcagaaaatggaagaaaacataagaaggatt
gacagattctacaaacgcttagagttagctttgaaaactgccatcagtgctaacaactca
ccgtctgaggagacagcgaaaagtcgtgctgtgtacgttcgcagaagaaagagaaagacc
attcaagaacaagacgtacgtacctctccaaaggatcacaatgaagcattggagcccgag
gatgatacagaaagcagtcttgccagctctgtacaccgacagttggttagctcactcgcg
tattgttctgtgcggccagcacccagcctcaggtccggctgttgggcagaaagtcaaccg
aagcacacagtaacaggctctcttaccaggctgtga

DBGET integrated database retrieval system