KEGG   Falco peregrinus (peregrine falcon): 101920025
Entry
101920025         CDS       T02856                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00230  Purine metabolism
fpg00240  Pyrimidine metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101920025
   00240 Pyrimidine metabolism
    101920025
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101920025
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 101920025
NCBI-ProteinID: XP_013158947
Position
Un
AA seq 271 aa
MSTPAKRHCRSPTGSLDFSFQKRLKKISIEGNIAAGKSTFVRLLEKHSDEWEVIPEPIAK
WCNVQTADNEYEELSTSQKNGGNLLKMLYDKPTRWAYTFQTYACLSRVRAQLKPISAKLH
EAEHPVQFFERSVYSDRYVFASNLFESGNINETEWTIYQDWHMWLLNQFESDLELDGMIY
LRTTPQKCKERLQMRGREEEQGIELEYLENLHNKHEAWLYERTMRVDFENLKEIPILVLD
VDEDFKNDKIKQEYLIDQVSIKYFLISALLQ
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtccaccccggccaagcggcactgccgcagccccaccggctccctcgacttcagcttc
cagaagcgcctcaagaagatttctatcgaagggaacatcgctgcggggaagtcaacgttt
gtcaggctgctggagaaacacagtgacgagtgggaggtcatccctgaacccatcgccaag
tggtgcaacgtccaaacagccgacaacgagtacgaggagctttcaacatctcagaagaac
ggaggaaatctacttaaaatgctgtatgataaacccacaagatgggcttacacatttcag
acttacgcttgcttgagtagagtaagagcgcaattaaaacccatctcagccaagctacat
gaagcagaacatccagtgcaattttttgaaagatctgtgtacagtgacagatacgtattt
gcttctaacctgtttgagtctggaaacattaatgaaactgagtggacaatttatcaggac
tggcacatgtggcttttgaatcagtttgaatcagacctagaactggatggcatgatctac
ctaagaaccacacctcagaaatgcaaggaaaggctacagatgaggggaagagaagaggaa
caaggaattgaacttgagtatttggaaaacctccacaataaacatgaagcctggctttat
gaaaggactatgagagttgattttgagaaccttaaagaaattcccatcctagttttggat
gttgatgaagattttaagaatgataagattaaacaggagtatttgattgaccaggtaagt
attaagtattttctcatatctgctcttctgcagtaa

DBGET integrated database retrieval system